2026-04-18T08:02:14Z https://publikasi.mercubuana.ac.id/index.php/jimb/oai

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/7 2014-10-28T00:15:36Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1081 2017-03-13T20:21:57Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16603 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1264 2017-07-30T04:13:59Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10571 2021-01-04T07:52:27Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3881 2018-09-12T08:48:44Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/401 2019-08-14T09:26:23Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16507 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1234 2017-03-22T20:35:38Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9606 2020-09-03T17:37:36Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15396 2023-08-10T21:47:20Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/478 2016-10-26T18:44:24Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22285 2024-09-30T02:02:25Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13550 2023-08-10T21:47:36Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16138 2023-08-10T21:47:20Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/200 2016-09-15T00:04:32Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16894 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/207 2015-11-25T01:44:57Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6760 2019-09-04T01:49:37Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6560 2022-01-03T14:51:08Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/361 2016-04-12T19:25:18Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2281 2018-09-05T04:42:00Z jrs:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3825 2018-09-07T12:23:42Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/365 2016-10-26T18:45:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15785 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9601 2020-09-03T17:37:36Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/12231 2023-08-10T21:28:22Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/181 2016-09-15T00:10:43Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/170 2016-09-15T00:11:10Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17198 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/307 2016-04-12T21:46:41Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/11449 2024-05-10T09:53:12Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/688 2016-08-09T22:01:51Z Jurnal_Mix:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/64 2015-05-06T01:22:46Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/411 2019-08-14T09:26:23Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/390 2016-04-12T04:17:18Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3248 2018-07-21T10:51:45Z narada:ED

oai:ojs.publikasi.mercubuana.ac.id:article/1530 2021-03-04T02:58:32Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/697 2016-10-31T01:36:23Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4363 2019-02-18T08:22:37Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16865 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1468 2017-05-30T00:52:33Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9839 2020-10-08T03:39:21Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/21653 2023-07-19T16:01:36Z ijiem:FM driver

oai:ojs.publikasi.mercubuana.ac.id:article/192 2016-09-15T00:09:47Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16855 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/285 2016-04-11T03:40:58Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/36891 2026-01-12T02:49:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/12842 2021-08-10T03:56:07Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/641 2016-06-13T22:38:59Z provita:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/16 2015-05-05T12:26:49Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6344 2019-08-02T04:01:22Z indikator:ART

oai:ojs.publikasi.mercubuana.ac.id:article/374 2016-04-12T03:54:39Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1417 2018-06-03T21:26:43Z provita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1821 2021-03-04T02:58:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/2558 2018-03-27T03:57:23Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4410 2018-11-21T04:10:41Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17236 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1418 2017-05-09T01:04:16Z provita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9829 2020-10-07T17:17:57Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3761 2018-09-05T08:15:36Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2559 2018-03-27T04:02:19Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/37577 2026-03-16T01:39:37Z merpsy:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2421 2019-11-25T08:36:11Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3037 2022-06-17T16:16:00Z marcommers:ART

oai:ojs.publikasi.mercubuana.ac.id:article/429 2016-04-12T18:12:08Z pasti:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/21 2015-02-03T19:34:20Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1205 2017-03-22T19:17:02Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2387 2019-11-25T02:48:59Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17164 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/903 2017-07-30T04:14:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1814 2021-03-04T02:58:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3890 2018-10-10T08:27:57Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/11603 2023-08-10T21:28:33Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4117 2018-10-10T08:39:46Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16018 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1240 2017-03-22T20:35:38Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4272 2020-06-08T08:10:11Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13207 2023-08-10T21:47:27Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/404 2016-10-26T18:45:01Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4941 2024-07-05T15:15:27Z ihasj:ART

oai:ojs.publikasi.mercubuana.ac.id:article/19363 2023-02-13T02:56:52Z cda:ART

oai:ojs.publikasi.mercubuana.ac.id:article/206 2016-09-15T00:04:33Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16971 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/210 2016-02-21T20:29:19Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2445 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/17122 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1485 2017-06-02T21:20:52Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1089 2020-10-18T09:32:07Z jpma:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3206 2018-09-07T11:05:06Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/424 2016-10-26T18:45:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16882 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1247 2017-03-19T10:39:59Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4760 2020-03-01T16:21:23Z fasilkom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13006 2023-08-10T21:28:22Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/347 2016-10-26T18:44:24Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22281 2024-09-30T02:02:25Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15733 2022-07-11T23:14:54Z mbcie:ART

oai:ojs.publikasi.mercubuana.ac.id:article/251 2016-09-15T00:02:53Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16873 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/70 2015-05-06T01:22:46Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5154 2019-10-14T04:27:05Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10143 2021-05-08T03:59:49Z jdm:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/417 2016-04-12T07:02:39Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3155 2018-07-11T11:29:35Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/972 2017-01-09T20:23:10Z virtuvian:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5546 2019-04-30T08:49:26Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/30270 2024-09-30T08:49:18Z sinergi:FRM driver

oai:ojs.publikasi.mercubuana.ac.id:article/7295 2019-12-05T12:22:36Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13041 2023-08-10T21:47:14Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/177 2016-09-15T00:10:42Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3795 2018-09-12T08:48:44Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17348 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/352 2016-04-12T19:03:57Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6561 2022-01-06T14:04:11Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/651 2016-06-22T20:39:42Z tekun:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/68 2015-05-06T01:22:46Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/403 2019-08-14T09:26:23Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/357 2016-04-12T03:32:39Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2944 2018-06-09T18:31:17Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1526 2021-03-04T02:58:31Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/693 2016-10-31T01:36:23Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5151 2019-02-18T07:49:58Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16619 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1463 2017-05-30T00:52:33Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10063 2020-12-22T07:02:42Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3786 2018-09-06T03:22:30Z jrs:ART

oai:ojs.publikasi.mercubuana.ac.id:article/268 2016-04-11T00:47:48Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2450 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/12825 2021-08-13T02:12:39Z fifo:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/1 2015-05-05T12:26:45Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5563 2019-06-18T09:52:23Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16526 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/346 2016-04-12T03:04:13Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/909 2017-07-30T04:14:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10596 2021-01-06T10:06:32Z Incomtech:FRM driver

oai:ojs.publikasi.mercubuana.ac.id:article/2418 2018-04-19T03:23:03Z jies:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3806 2018-10-16T07:55:33Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16540 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1305 2017-03-23T03:54:10Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9559 2020-08-30T04:21:11Z sinergi:FRM

oai:ojs.publikasi.mercubuana.ac.id:article/2344 2018-03-27T03:45:15Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/21991 2024-11-21T09:55:37Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/19368 2023-02-13T02:56:52Z cda:ART

oai:ojs.publikasi.mercubuana.ac.id:article/187 2016-09-15T00:09:45Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17358 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/8 2014-10-28T00:15:36Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1229 2017-03-18T09:27:58Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17197 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1265 2017-07-30T04:13:59Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5817 2020-11-03T04:52:40Z virtuvian:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3885 2018-09-12T08:48:44Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/398 2019-08-14T09:26:23Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16686 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1235 2017-03-22T20:35:38Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13580 2023-08-10T21:28:33Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13914 2023-08-10T21:28:33Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/368 2016-10-26T18:44:24Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22286 2024-09-30T02:02:25Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13256 2023-08-10T21:47:36Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17944 2023-01-04T04:52:04Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/201 2016-09-15T00:04:32Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17178 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/208 2015-11-25T01:44:57Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5272 2019-09-03T04:52:45Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15274 2022-04-06T07:16:44Z swot:ART

oai:ojs.publikasi.mercubuana.ac.id:article/441 2016-04-12T19:17:11Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3744 2018-09-06T02:14:03Z jrs:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10570 2021-01-04T07:52:13Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3660 2018-09-08T01:53:09Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/418 2016-10-26T18:45:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17015 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1091 2017-03-22T19:17:02Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/8411 2020-06-04T12:49:23Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/12164 2023-08-10T21:28:22Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/167 2016-09-15T00:11:10Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/171 2016-09-15T00:11:10Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16510 2025-05-20T07:36:20Z jonem:ART

oai:ojs.publikasi.mercubuana.ac.id:article/343 2016-04-12T02:16:50Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13718 2021-11-05T12:31:16Z adimassi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/414 2016-08-30T23:23:55Z viskom:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/63 2015-05-06T01:22:46Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6759 2019-08-27T08:35:44Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/12960 2023-08-10T21:47:14Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/392 2016-04-12T04:20:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3234 2018-07-21T10:55:14Z narada:ED

oai:ojs.publikasi.mercubuana.ac.id:article/1531 2021-03-04T02:58:32Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/698 2016-10-31T01:36:24Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5519 2019-04-30T03:37:28Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16888 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1469 2017-05-30T00:52:33Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2422 2019-11-25T08:36:11Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/21115 2023-07-19T12:40:43Z mbcie:ART

oai:ojs.publikasi.mercubuana.ac.id:article/183 2016-09-15T00:10:17Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17205 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/286 2016-04-11T03:40:58Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/32749 2025-09-15T08:57:44Z reputasi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/14022 2021-12-20T08:34:57Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/647 2016-06-22T02:20:51Z tekun:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/17 2015-05-05T12:26:49Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6506 2019-08-08T06:10:53Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/369 2016-04-12T03:47:16Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2808 2018-05-21T03:38:08Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1522 2021-03-04T02:58:31Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/689 2016-10-31T01:36:22Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4407 2018-11-21T02:25:05Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17171 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1416 2017-05-09T01:04:32Z provita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1820 2021-03-04T02:58:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3743 2018-09-05T08:15:07Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1437 2018-03-27T04:08:27Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/38017 2026-03-05T01:51:39Z bmw:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2446 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/6713 2021-05-22T13:18:24Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/500 2016-04-14T00:53:45Z oe:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/10 2015-02-03T21:45:19Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17203 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/904 2017-07-30T04:14:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1813 2021-03-04T02:58:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3891 2018-10-10T08:27:58Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6364 2019-08-26T15:23:23Z indikator:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4118 2018-10-10T08:39:46Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16023 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1241 2017-03-22T20:35:38Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/8417 2020-06-04T12:49:23Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/13788 2023-08-10T21:47:27Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1711 2017-10-10T23:23:34Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17170 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/19364 2023-02-13T02:56:52Z cda:ART

oai:ojs.publikasi.mercubuana.ac.id:article/193 2016-09-15T00:08:52Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16104 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/211 2016-02-18T19:27:49Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5582 2019-05-03T08:25:18Z swot:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17177 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1261 2017-07-30T04:13:59Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1084 2020-10-18T09:32:07Z jpma:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3797 2018-09-12T08:48:44Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/423 2016-10-26T18:45:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16683 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1246 2017-03-19T10:39:59Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9603 2020-09-03T17:37:36Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/12990 2023-08-10T21:28:22Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/349 2016-10-26T18:44:24Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22282 2024-09-30T02:02:25Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/14215 2022-07-04T06:08:40Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/252 2016-09-15T00:02:53Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16847 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/209 2015-11-25T01:41:50Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2354 2019-11-25T02:56:11Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/14247 2022-03-30T07:41:44Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/354 2016-04-12T21:16:26Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3156 2018-07-11T11:29:35Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1065 2017-02-10T00:46:37Z jrs:ART

oai:ojs.publikasi.mercubuana.ac.id:article/30630 2024-11-04T01:25:37Z pemanas:ART

oai:ojs.publikasi.mercubuana.ac.id:article/7441 2019-12-26T14:54:33Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/11595 2023-08-10T21:28:29Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/178 2016-09-15T00:10:42Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3882 2018-09-12T03:46:16Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16889 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/341 2016-04-12T19:20:53Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/20892 2023-07-23T04:16:30Z mbcie:ART

oai:ojs.publikasi.mercubuana.ac.id:article/652 2016-06-22T20:43:51Z tekun:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/67 2015-05-06T01:22:46Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/405 2019-08-14T09:26:23Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/358 2016-04-12T03:32:39Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3144 2018-07-11T03:41:24Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1527 2021-03-04T02:58:31Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/694 2016-10-31T01:36:23Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5149 2019-02-18T07:49:58Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17169 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1464 2017-05-30T00:52:33Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/14120 2023-08-10T21:28:33Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3764 2018-09-06T04:38:59Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17359 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/269 2016-04-11T00:54:58Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2451 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/11953 2021-06-07T04:42:39Z swot:ART driver

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/3 2015-05-05T12:26:45Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5566 2019-06-18T09:52:23Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16879 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/302 2016-04-12T03:20:55Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/910 2017-07-30T04:14:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10595 2021-01-06T10:06:32Z Incomtech:FRM driver

oai:ojs.publikasi.mercubuana.ac.id:article/1871 2018-04-04T04:42:59Z jrs:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4176 2018-10-16T07:58:00Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16875 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1411 2017-05-09T00:00:19Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9607 2020-09-03T17:37:36Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/412 2017-08-29T07:01:04Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15982 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/19369 2023-02-13T02:56:52Z cda:ART

oai:ojs.publikasi.mercubuana.ac.id:article/188 2016-09-15T00:09:45Z jte:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/6 2014-10-28T00:15:36Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1232 2017-03-18T11:44:52Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2173 2019-11-25T02:56:11Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16111 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1266 2017-07-30T04:13:59Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10568 2021-01-04T07:27:40Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3886 2018-09-12T08:48:44Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/397 2019-08-14T09:26:23Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3893 2018-10-10T08:27:58Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16852 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1236 2017-03-22T20:35:38Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9564 2020-08-30T09:08:27Z Incomtech:FRM driver

oai:ojs.publikasi.mercubuana.ac.id:article/18912 2023-05-01T03:59:52Z jdm:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/377 2016-10-26T18:44:24Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22287 2024-09-30T02:02:25Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13176 2023-08-10T21:47:36Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15971 2023-08-10T21:47:20Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/202 2016-09-15T00:04:32Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17183 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/166 2015-11-08T20:42:59Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2388 2019-11-25T02:48:59Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6362 2021-05-22T12:51:20Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/272 2016-04-12T21:43:32Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3763 2018-09-05T09:19:29Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1470 2017-05-30T00:52:33Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10565 2021-01-04T07:45:29Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3158 2018-09-07T12:08:04Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/419 2016-10-26T18:45:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17173 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1092 2017-03-22T19:17:02Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9598 2020-09-03T17:37:35Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22289 2023-08-09T07:04:53Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/168 2016-09-15T00:11:10Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/782 2016-09-17T23:45:55Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/14568 2025-07-05T16:55:28Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/348 2016-04-12T20:18:45Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13719 2021-11-05T12:46:10Z adimassi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/716 2016-09-07T06:50:44Z sinergi:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/62 2015-05-06T01:22:46Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6762 2019-08-27T08:44:52Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/380 2022-06-14T02:15:08Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/394 2016-04-12T04:43:18Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3250 2018-07-21T10:59:40Z narada:ED

oai:ojs.publikasi.mercubuana.ac.id:article/11054 2021-04-12T06:58:51Z jtm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/834 2016-11-03T02:33:01Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3236 2019-02-27T13:00:56Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15889 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2423 2019-11-25T08:36:11Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/26638 2025-05-15T08:09:38Z narada:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/184 2016-09-15T00:10:17Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16026 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/287 2016-04-11T03:40:58Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2416 2019-11-25T08:36:11Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/12287 2021-07-13T02:45:43Z sinergi:FRM driver

oai:ojs.publikasi.mercubuana.ac.id:article/648 2016-06-22T20:22:51Z tekun:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/18 2015-05-05T12:26:53Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/12672 2021-12-20T08:39:11Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/448 2016-04-12T20:40:01Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2807 2018-05-21T02:53:44Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1523 2021-03-04T02:58:31Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/690 2016-10-31T01:36:23Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5152 2019-02-18T07:49:58Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17002 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1419 2017-05-09T01:13:32Z provita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9609 2020-09-04T03:25:03Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3794 2018-09-06T04:38:59Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1339 2017-09-08T00:35:10Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/38192 2026-03-05T01:51:59Z bmw:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2447 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/12697 2022-02-10T07:31:08Z jitkom:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/504 2016-04-14T01:15:22Z oe:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/45 2015-03-13T21:09:07Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1902 2019-06-21T05:35:20Z virtuvian:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17116 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/905 2017-07-30T04:14:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1815 2021-03-04T02:58:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3892 2018-10-10T08:27:58Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6758 2019-08-27T08:35:44Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4119 2018-10-10T08:39:46Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16024 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1243 2017-03-22T20:35:38Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9597 2020-09-03T17:37:35Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/14960 2023-08-10T21:47:27Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1085 2018-03-29T08:44:33Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16778 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/19365 2023-02-13T02:56:52Z cda:ART

oai:ojs.publikasi.mercubuana.ac.id:article/194 2016-09-15T00:08:52Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16902 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/196 2016-02-18T19:28:18Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2172 2019-11-25T02:56:11Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16777 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1262 2017-07-30T04:13:59Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1819 2021-03-04T02:58:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3800 2018-09-12T08:48:44Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/422 2016-10-26T18:45:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16685 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1242 2017-03-19T00:33:05Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/7704 2020-02-04T16:58:10Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/12945 2023-08-10T21:28:22Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/473 2016-10-26T18:44:24Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22283 2024-09-30T02:02:25Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15362 2023-08-10T21:47:27Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15004 2022-12-15T06:30:27Z marcommers:ART

oai:ojs.publikasi.mercubuana.ac.id:article/248 2016-09-15T00:02:55Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15807 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/145 2015-08-20T18:57:32Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6763 2019-09-04T01:49:39Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/7426 2021-05-21T14:18:08Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/371 2016-04-12T21:10:18Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2936 2018-06-09T18:28:39Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1082 2017-02-22T21:11:10Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16916 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/7442 2019-12-26T23:22:58Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/16800 2024-07-15T05:27:52Z jfm:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/179 2016-09-15T00:10:42Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3817 2018-09-07T06:16:58Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16893 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/309 2016-04-12T19:22:06Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13591 2023-08-10T21:28:33Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/653 2016-06-22T20:46:54Z tekun:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/66 2015-05-06T01:22:46Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/407 2019-08-14T09:26:23Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/385 2016-04-12T04:11:10Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3141 2018-07-11T03:41:35Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1528 2021-03-04T02:58:31Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/695 2016-10-31T01:36:23Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5150 2019-02-18T07:49:58Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16928 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1466 2017-05-30T00:52:33Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10201 2020-12-22T07:01:21Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3789 2018-09-06T03:04:11Z jrs:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17213 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/275 2016-04-12T19:43:22Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2452 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/11965 2021-06-07T04:42:19Z swot:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/614 2016-05-10T06:35:46Z Jurnal_Mix:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/4 2015-05-05T12:26:45Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5561 2019-06-18T09:52:23Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17172 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/378 2016-04-12T04:02:37Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/911 2017-07-30T04:14:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10597 2021-01-06T10:06:24Z Incomtech:FRM driver

oai:ojs.publikasi.mercubuana.ac.id:article/1088 2018-03-29T08:44:33Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4178 2018-10-16T08:02:19Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16891 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1412 2017-05-09T00:06:51Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9608 2020-09-03T17:37:36Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3762 2018-09-05T09:19:29Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/384 2017-08-29T06:43:26Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16908 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2419 2019-11-25T08:36:11Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/10038 2023-02-14T13:25:09Z virtuvian:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/190 2016-09-15T00:09:47Z jte:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/5 2014-10-28T18:52:01Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1233 2017-03-18T11:44:52Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16088 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1267 2017-07-30T04:13:59Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1817 2021-03-04T02:58:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3888 2018-10-10T08:27:57Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/396 2019-08-14T09:26:23Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3894 2018-10-10T08:27:58Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16924 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1237 2017-03-22T20:35:38Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9561 2020-08-30T04:21:11Z sinergi:FRM driver

oai:ojs.publikasi.mercubuana.ac.id:article/14959 2023-08-10T21:47:36Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/373 2016-10-26T18:44:24Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22288 2024-09-30T02:02:25Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13144 2023-08-10T21:47:36Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15397 2023-08-10T21:47:20Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/203 2016-09-15T00:04:32Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16078 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/234 2016-02-19T03:09:09Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2440 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/14910 2022-02-17T12:10:44Z jonem:ART

oai:ojs.publikasi.mercubuana.ac.id:article/274 2016-04-12T19:00:25Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1471 2017-05-30T00:52:33Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13779 2023-08-10T21:28:33Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3796 2018-09-12T08:48:44Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/420 2016-10-26T18:45:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17253 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1238 2017-03-18T23:30:28Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9599 2020-09-03T17:37:36Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13323 2023-08-10T21:28:22Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/342 2016-10-26T18:44:24Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/31146 2024-12-04T03:02:52Z virtuvian:CVR

oai:ojs.publikasi.mercubuana.ac.id:article/15034 2022-11-01T03:03:46Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/731 2016-09-14T19:52:23Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17179 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/61 2015-05-06T01:22:46Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4487 2019-08-28T06:21:35Z narada:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6562 2021-05-21T13:05:58Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/363 2016-04-12T21:06:38Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3249 2018-07-21T10:59:40Z narada:ED

oai:ojs.publikasi.mercubuana.ac.id:article/11394 2021-03-05T15:14:26Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/893 2016-11-29T21:26:21Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3229 2019-03-20T02:49:13Z narada:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16726 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2424 2019-11-25T08:36:11Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/20624 2024-05-23T08:47:35Z jiess:ART

oai:ojs.publikasi.mercubuana.ac.id:article/185 2016-09-15T00:10:17Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16027 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/288 2016-04-11T03:40:58Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2417 2019-11-25T08:36:11Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/28061 2024-07-20T01:14:55Z mbcie:ART

oai:ojs.publikasi.mercubuana.ac.id:article/649 2016-06-22T20:30:38Z tekun:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/19 2015-05-05T12:26:53Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15281 2022-04-06T07:39:36Z swot:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/356 2016-04-12T20:57:05Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2802 2018-05-21T02:31:51Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1524 2021-03-04T02:58:31Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/691 2016-10-31T01:36:23Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5153 2019-02-18T07:49:58Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16909 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1465 2017-05-30T00:49:28Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/8734 2020-09-16T08:52:12Z jam:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3779 2018-09-06T04:38:59Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/375 2016-10-26T18:45:17Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22291 2024-09-30T02:02:25Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/229 2016-02-19T03:09:24Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2448 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/11804 2021-08-17T07:10:37Z fifo:Ilmu+Komputer

oai:ojs.publikasi.mercubuana.ac.id:article/547 2016-04-15T20:19:11Z jpio:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/48 2015-03-13T21:17:23Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5548 2019-06-18T09:52:23Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15832 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/907 2017-07-30T04:14:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1816 2021-03-04T02:58:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/1747 2018-06-03T21:26:43Z provita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3674 2018-10-16T06:11:05Z Incomtech:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16036 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1244 2017-03-22T20:35:38Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/7464 2020-03-01T15:40:48Z fasilkom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4422 2018-11-21T07:40:26Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/25409 2024-02-03T16:10:45Z collabit:ART

oai:ojs.publikasi.mercubuana.ac.id:article/19366 2023-02-13T02:56:52Z cda:ART

oai:ojs.publikasi.mercubuana.ac.id:article/195 2016-09-15T00:08:52Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17280 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/2 2014-10-22T00:30:22Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1086 2017-02-22T21:11:10Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6344 2019-08-02T04:01:22Z indikator:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16497 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1263 2017-07-30T04:13:59Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10572 2021-01-04T07:52:28Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3877 2018-09-12T08:48:44Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/421 2016-10-26T18:45:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16896 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1251 2017-03-19T10:32:48Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/12939 2023-08-10T21:47:14Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17168 2023-05-08T08:31:11Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/475 2016-10-26T18:44:24Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22284 2024-09-30T02:02:25Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13543 2023-08-10T21:47:36Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16926 2023-08-10T21:47:20Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/249 2016-09-15T00:02:55Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16885 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/143 2015-08-20T18:57:32Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6761 2019-09-04T01:49:39Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6753 2021-05-22T11:22:55Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/386 2016-04-12T19:27:35Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3778 2018-09-06T03:04:11Z jrs:ART

oai:ojs.publikasi.mercubuana.ac.id:article/415 2016-10-26T18:45:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17162 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9602 2020-09-03T17:37:36Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/12801 2023-08-10T21:28:22Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/180 2016-09-15T00:10:43Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3662 2018-08-31T05:46:50Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/169 2016-09-15T00:11:10Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17201 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/310 2016-04-11T05:39:44Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/12819 2021-12-20T07:41:32Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/654 2016-06-22T20:50:47Z tekun:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/65 2015-05-06T01:22:46Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/409 2019-08-14T09:26:23Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/388 2016-04-12T04:15:35Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3319 2018-08-06T03:58:34Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1532 2021-03-04T02:58:31Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/696 2016-10-31T01:36:23Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5294 2019-08-01T03:01:30Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16791 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1467 2017-05-30T00:52:33Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9840 2020-10-08T03:39:21Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/191 2016-09-15T00:09:47Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16895 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/292 2016-04-12T19:06:55Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2453 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/11964 2021-06-07T04:42:19Z swot:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/640 2016-06-13T22:38:59Z provita:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/14 2015-05-05T12:26:49Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3221 2019-06-18T09:52:23Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17176 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/382 2016-04-12T04:05:37Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/912 2017-07-30T04:14:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10832 2021-01-30T03:12:21Z swot:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/1859 2017-10-21T00:45:30Z jrs:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4418 2018-11-21T04:53:10Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17038 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1410 2017-05-09T00:47:00Z provita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/8733 2020-09-16T08:52:15Z jam:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3757 2018-09-05T08:21:13Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/353 2016-10-26T18:45:17Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/20950 2023-12-22T07:51:00Z terbitan:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2420 2019-11-25T08:36:11Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/13047 2023-08-10T21:47:14Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/381 2016-04-12T19:14:45Z viskom:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/23 2015-02-03T19:34:20Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1249 2017-03-19T10:39:59Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2385 2019-11-25T02:48:59Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17081 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/902 2017-07-30T04:14:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1812 2021-03-04T02:58:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3889 2018-10-10T08:27:57Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/393 2019-08-14T09:26:23Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3895 2018-10-10T08:27:58Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17163 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1239 2017-03-22T20:35:38Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/8300 2020-08-12T06:51:34Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13182 2023-08-10T21:47:27Z jpma:ART

oai:ojs.publikasi.mercubuana.ac.id:article/400 2016-10-26T18:45:01Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13771 2023-08-31T05:12:11Z adimassi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/19357 2023-02-13T02:56:52Z cda:ART

oai:ojs.publikasi.mercubuana.ac.id:article/205 2016-09-15T00:04:32Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17083 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/182 2016-02-18T19:27:33Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2444 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/6754 2021-05-22T12:51:20Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/16968 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1472 2017-05-30T00:52:33Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9835 2020-10-08T08:47:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3207 2018-09-07T11:05:06Z oe:ART

oai:ojs.publikasi.mercubuana.ac.id:article/425 2016-10-26T18:45:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/20376 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1248 2017-03-19T10:39:59Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9600 2020-09-03T17:37:36Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13025 2023-08-10T21:28:22Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/344 2016-10-26T18:44:24Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/22290 2024-09-30T02:02:25Z mediakom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/14385 2022-11-08T04:31:48Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/250 2016-09-15T00:02:52Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16758 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/60 2015-05-06T01:22:22Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2170 2019-11-25T02:56:11Z pasti:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13417 2023-08-10T21:28:33Z profita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/416 2016-04-12T07:02:39Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3165 2018-08-01T07:41:14Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10009 2021-03-17T03:16:34Z indikator:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/971 2017-01-09T20:03:07Z virtuvian:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5544 2019-04-30T08:43:25Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/30271 2024-09-30T08:47:48Z sinergi:FRM driver

oai:ojs.publikasi.mercubuana.ac.id:article/2425 2019-11-25T08:36:11Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/19583 2023-02-23T02:21:41Z swot:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/186 2016-09-15T00:10:17Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16030 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/290 2016-04-11T03:40:58Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13028 2021-08-20T01:26:28Z Incomtech:FRM driver

oai:ojs.publikasi.mercubuana.ac.id:article/650 2016-06-22T20:34:58Z tekun:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/69 2015-05-06T01:22:46Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15700 2022-06-21T09:07:36Z mbcie:ART

oai:ojs.publikasi.mercubuana.ac.id:article/355 2016-04-12T03:32:39Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1420 2018-06-03T21:26:58Z provita:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1525 2021-03-04T02:58:31Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/692 2016-10-31T01:36:23Z Jurnal_Mix:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4577 2019-08-08T09:31:42Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16860 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1484 2017-05-30T00:49:52Z format:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1818 2021-03-04T02:58:15Z format:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/3765 2018-09-06T04:38:59Z jdm:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1729 2017-09-14T23:32:57Z virtuvian:ART

oai:ojs.publikasi.mercubuana.ac.id:article/265 2016-04-11T00:27:35Z tekun:ART

oai:ojs.publikasi.mercubuana.ac.id:article/2449 2019-11-25T08:35:23Z jies:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/6757 2021-08-16T13:57:45Z ihasj:ART

oai:ojs.publikasi.mercubuana.ac.id:article/337 2016-04-19T23:29:12Z tekun:ART

oai:ojs.publikasi.pasca.mercubuana.ac.id:article/49 2015-03-13T21:17:23Z sinergi:ART

oai:ojs.publikasi.mercubuana.ac.id:article/5562 2019-06-18T09:52:23Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/16160 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/908 2017-07-30T04:14:06Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/10599 2021-01-06T10:06:39Z Incomtech:BCM driver

oai:ojs.publikasi.mercubuana.ac.id:article/2164 2018-04-24T08:03:13Z biopsikososial:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4177 2018-10-16T07:58:00Z viskom:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17133 2024-05-07T01:14:32Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/1245 2017-03-22T20:35:38Z fifo:ART

oai:ojs.publikasi.mercubuana.ac.id:article/9560 2020-08-30T04:21:11Z sinergi:FRM driver

oai:ojs.publikasi.mercubuana.ac.id:article/2270 2018-02-03T12:46:02Z fasilkom:No+%3D+Nomor

oai:ojs.publikasi.mercubuana.ac.id:article/25161 2024-01-10T14:43:01Z mbcie:ART

oai:ojs.publikasi.mercubuana.ac.id:article/19367 2023-02-13T02:56:52Z cda:ART

oai:ojs.publikasi.mercubuana.ac.id:article/197 2016-09-15T00:08:52Z jte:ART

oai:ojs.publikasi.mercubuana.ac.id:article/17311 2024-05-07T01:14:33Z iprc:ART

oai:ojs.publikasi.mercubuana.ac.id:article/4405 2018-11-19T07:45:30Z jimb:ART driver

PENGARUH WORK-TO-FAMILY CONFLICT DAN FAMILY-TO-WORK CONFLICT TERHADAP KEPUASAN KERJA KARYAWAN. STUDI PADA KARYAWAN DI KANTOR PERPUSTAKAAN NASIONAL REPUBLIK INDONESIA, JAKARTA Sihite, Reymonda Arianto, Yohanes konflik pekerjaan-ke-keluarga; konflik keluarga-ke-pekerjaan; kepuasan kerja; Penelitian ini membahas tentang pengaruh konflik keluarga terhadap kepuasankerja.Variabel independen yang digunakan dalam penelitian ini adalah konflik pekerjaan-kekeluargadan konflik keluarga-ke-pekerjaan,sedangkanvariabel dependenadalah kepuasan kerja.Dataprimerdigunakandalampenelitianiniyangdiperolehsecaralangsungmelaluimetodesurveydarisampel64orang diPerpustakaanNasionalRIdengankuesioner.Analisisyangdigunakandalampenelitianini adalah regresi linear berganda,uji-F,uji-T dan hipotesis.Hasildalampenelitianiniadalah terdapat pengaruh yangsignifikandarivariabel konflik pekerjaan-ke-keluarga danterdapatpengaruh yangtidaksignifikandari variabelkonflikkeluarga-ke-pekerjaan terhadap kepuasan kerja karyawan.Lingkungan kerja yang mendukung dan jadwal kerja yang fleksibel dapatmemainkan peran penting untuk meminimalkan dampak konflik yang tidak menguntungkanini.Studi ini berkontribusi untuk membangun basis pengetahuan yang ada dalam menangani konflikperan ganda ditempat kerja untuk lebih memaksimalkan pengelolaan Sumber Daya Manusia yangstrategis. Universitas Mercu Buana 2018-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4405 10.22441/jimb.v4i1.4405 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 1 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 138-151 2655-7274 2460-8424 10.22441/jimb.v4i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4405/2175 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3986 2019-07-05T15:08:02Z jimb:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/11490 2021-03-31T18:29:58Z jimb:ART driver

MEASURING THE EXPORT POTENTIAL OF TOBACCO INDUSTRY AND INDONESIAN TOBBACO PRODUCTS Nasim, Eman Sulaeman Gunawijaya, Jajang International trade, tobacco, cigarette, eksport potential, input-output Smoking is one of activities that is deeply rooted in Indonesian culture so that the economic contribution from this actvities is quite significant in the Indonesian economy. Along with the development of various policy discourses that counter the development of the tobacco industry and processed tobacco products, such as an increase in excise rates for tobacco (CHT) also there is shock of pandemic situation, the sustainability of local tobacco industry needs to be a concern and also has to be prompted the urgency to expand the market to another countries through export activities. This research aims to measure the impact of the potential utilization of tobacco and processed tobacco commodity export activities by considering production capacity, available policy frameworks, and challenges that faced by industrial actors. By using quantitative approach through  the calculation of Input-Output Tables, as well in-depth literature studies on the eport regulatory framework in Indonesia and in other countries also related studies on the opportunities and challenges of tobacco commodity exporters,this research succeeded in providing several findings. By considering the scale of production and eksport opportunities in trade balance deficit countries for tobacco commodities and their derivative products, the measured export potential is in the range of 17.5 bilion – 34.9 bilion USD, which 17.5 bilion USD if Indonesia export to countries with trade deficit ba;ance which has income per capita lower than Indonesia and 34.9 bilion USD when Indonesia is able to export to 20 major countries with the largest trade deficit balance. Policies that need to be taken to archieve this potential include uniformity of commodity quality standarts with international standards, encouraging production incentive policies through subsidy scheme and capital goods grants, and reducing export duties on several suppoting components of tobacco production and its derivatives. Universitas Mercu Buana 2021-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11490 10.22441/jimb.v7i1.11490 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 1 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 1-35 2655-7274 2460-8424 10.22441/jimb.v7i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11490/4357 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3545 2018-08-25T05:35:19Z jimb:ART driver

PENERAPAN CASH FLOW MANAGEMENT MELALUI ANALISA RASIO UNTUK SUSTAINABILITAS UMKM (Studi kasus pada CV Jayanti Utama peternak burung puyuh Bogor) Wahyuningsih, Diah Cash Flow Management; analisa rasio; arus kas; profitabilitas; Keberadaan UMKM yang mejadi tulang punggung perekonomian suatu negara diberbagibelahan dunia, justru banyak yang mengalami kebangkrutan. Penelitian menunjukkansalah satu penyebab adalah tidak adanya Cash flow management yang baik. Oleh karenaitu penelitian inidilakukan dengan tujuan untuk menunjukkan penerapan Cash flowmanagement melalui penyusunan laporan arus kas, sehingga diperoleh informasi bagipengelola dalam analisadan prediksi usaha. Penelitian dilakukan dengan studi kasus padaUMKM telur puyuh, dan hasil penelitian menyimpulkan bahwa dengan tidakditerapkannya Cash flow management, pengelola kesulitan dalam melakukan analisa danprediksi usaha yang terlihat dari menurunnya jumlah produksi di periode akhir. Denganmanajemen arus kas, dapat meningkatkan profitabilitas, sustainability, dan perencanaandimasa yang akan datang. Universitas Mercu Buana 2018-08-24 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3545 10.22441/jimb.v3i1.3545 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 1 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 48-58 2655-7274 2460-8424 10.22441/jimb.v3i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3545/1879 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3852 2018-09-10T02:41:12Z jimb:ART driver

PENGARUH GAYA KEPEMIMPINAN PATERNALISTIS, DISIPLIN KERJA DAN LINGKUNGAN KERJA TERHADAP PRODUKTIVITAS KERJA KARYAWAN PADA DEPARTEMEN NONTEHNIK PT ASURANSIKPO AMBASADOR Sadikin, Mochamad Rizki Mianti, Tio Paternalistic Leadership Style; Working Discipline; Work Environment; Employees Productivity; Penelitian ini bertujuan untuk mengetahui pengaruh gaya kepemimpinan paternalistis, disiplin kerja dan lingkungan kerja terhadap produktivitas kerja karyawan pada departemen nontehnik PT. ASURANSI. Dimana diajukan tiga variabel bebas dan satu variabel terikat, yaitu pengaruh gaya kepemimpinan paternalistis, disiplin kerja dan lingkungan kerja sebagai variabel bebas dan produktivitas kerja berperan sebagai variabel terikat.Manfaat penelitian ini adalah penelitian kuantitatif dengan teknik pengumpulan data melalui penyebaran kuesioner dan data pustaka. Sampel pada penelitian ini adalah 45 orang karyawan departemen non tehnik PT. ASURANSI. Teknik analisis data yang digunakan adalah regresi linear berganda. Tahap pertama menguji validitas dan reabilitas pertanyaan setiap variabel. Tahap kedua dengan menguji hubungan variabel pengaruh gaya kepemimpinan paternalistis, disiplin kerja dan lingkungan kerja terhadap produktivitas kerja karyawan. Hasil penelitian menunjukan bahwa variabel gaya kepemimpinan paternalistis tidak berpengaruh signifikan terhadap produktivitas kerja, sedangkan disiplin kerja dan lingkungan kerja berpengaruh signifikan terhadap produktivitas kerja karyawan. Universitas Mercu Buana 2017-07-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3852 10.22441/jimb.v3i2.3852 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 2 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 253-266 2655-7274 2460-8424 10.22441/jimb.v3i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3852/2020 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/591 2018-09-03T03:15:44Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3693 2018-09-03T03:45:27Z jimb:ART driver

PENGARUH BUDAYA ORGANISASI DAN MOTIVASI KERJA TERHADAP KOMITMEN ORGANISASIONAL PADA PT. BANK CENTRAL ASIA, TBK. KANTOR CABANG UTAMA TANGERANG Sumanto, Sumanto Herminingsih, Anik organizational culture; work motivation; organizational commitment; his research was conducted to test the influence of organizational culture and the workmotivation toward organizational commitment in PT. Bank Central Asia, Tbk. – Tangerang main branchoffice because in the last two years this branch has not gotten any achievement from BCA Award contest,which is used as branch’s achievement benchmark. This quantitative research is causal, using nonprobability sampling method and involves 120 permanent employees as the research samples. The dataanalysis in this research used SPSS software 22th version. Based on t-test result, partially the organizationalculture has significant influence toward organizational commitment with t as 3.740, besides partiallythe work motivation has no significant influence toward organizational commitment with tcount as 1.852.Simultaneously, organizational culture and work motivation influence significantly toward organizationalcommitment with significance value 0.000. Result of the multiple linear regression analysis shows equationY=10,057+0,870X. 1+0,444X2 Universitas Mercu Buana 2016-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3693 10.22441/jimb.v2i1.3693 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 1 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 516-330 2655-7274 2460-8424 10.22441/jimb.v2i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3693/1904 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/26349 2025-08-20T14:28:46Z jimb:ART driver

Employees’ Job Satisfaction, Cooperative Schemes’ Benefits and Management of Agri-Environmental Institutions in South-West Nigeria Adeogun, Stephen Oluseun Adebayo, Olaoluwa Ayodeji Employees; Job Satisfaction; Cooperatives; Research Institutions; Nigeria This study investigates the relationship between employees' job satisfaction, cooperative schemes' benefits, and management practices in Southwest Nigeria. Through a mixed-methods approach, data was collected from 339 employees in various cooperatives of four selected agri-environmental institutions in the region. Results indicate that employees commonly access benefits such as loans and savings culture enhancement through cooperative schemes. Moreover, positive perceptions were found regarding cooperative schemes' management, with respondents expressing satisfaction with financial care and member involvement in decision-making. However, while overall job satisfaction levels were moderate, certain areas, such as job pride and recognition, received neutral responses. Correlation analysis revealed a significant positive relationship between cooperative schemes' management and job satisfaction (r = 0.307, p<0.01), while the relationship between cooperative schemes' benefits and job satisfaction was weak and statistically insignificant (r = -0.018, p>0.01). Based on these findings, it is recommended that organizations prioritize enhancing management practices, tailor benefits to employee needs, offer clear career development pathways and promote a positive work environment to improve job satisfaction and organizational success within cooperative schemes. Universitas Mercu Buana 2025-07-28 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/26349 10.22441/jimb.v11i2.26349 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 2 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 144-157 2655-7274 2460-8424 10.22441/jimb.v11i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/26349/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3508 2018-08-24T07:02:51Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/25846 2024-08-08T16:56:36Z jimb:ART driver

The Influence of Brand Image, Promotion and Product Quality on The Decision to Purchase A Honda Capella Batam Motorcycle Syntia, Kartini Realize, Realize Brand Image; Promotion; Quality Products; Purchase Decisions Need will increasing transportation _ increase open opportunity for industry automotive  specifically sector motorcycle . Many _ vehicle wheel two on the market _ moment This with various models, designs and tempting promotions , as well the price is equivalent with other companies and capable give product quality . Research purposes This is For know influence between variable brand image , promotion , and quality product to decision purchase of a Honda Capella Batam motorbike. Determination technique big sample using non-probability sampling. Data is processed using SPSS version 25. Analysis Method can started after all data from respondents and other sources have collected . With results study show that brand image , promotion and quality product in a way Partial influential positive and significant to decision Purchasing a Honda Capella motorbike, Batam . Based on anova test results with calculated f value > table f and sig < 0.05. Can concluded that variable brand image , promotion and quality product to own influence positive and significant to decision purchase Universitas Mercu Buana 2024-08-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25846 10.22441/jimb.v10i2.25846 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 2 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 157-170 2655-7274 2460-8424 10.22441/jimb.v10i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25846/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/25846/6006 Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6935 2020-07-27T02:42:04Z jimb:ART driver

Analisa Kompensasi,Kompetensi dan Kepuasan Kerja Terhadap Kinerja Unit Pelaynan PelangganKaryawan (Studi Kasus PT. KAI DAOP 1 Jakarta) Gani, Abdul Kompensasi, Kompetensi , Kepuasan Kerja dan Kinerja Karyawan Tujuan  penelitian  ini adalah untuk menganalisa  apakah terdapat  pengaruh aspek kompensasi, kompetensi dan kepuasan kerja  terhadap kinerja karyawan  di Divisi Pelayanan Pelanggan PT KAI  DAOP 1 Jakarta.Rumusan   masalah   penelitian adalah  apakah   aspek kompensasi, kompetensi dan kepuasan kerja  berpengaruh  positif terhadap kinerja pegawai. Tujuan  penelitian adalah untuk  mengetahaui  bagaimana   pengaruh kompensasi, kompetensi dan kepuasan kerja terhadap kinerja PT. KAI DAOP 1 JakartaJumlah populasi  adalah karyawan di Divisi Pelayanan Pelanggan PT. KAI DAOP 1 Jakarta sebanmyak  114  orang . Berdasarkan  penentuan  besarnya   sampel dengan menggunakan   rumus Slovin,  jumlah sampel dalam penelitian ini sebesar 115  responden. Teknik pengambilan sampel yang digunakan  dengan metode nonprobabilitysamplingMetode analisa data menggunakan pendekatan statistik  deskriptif  dengan melakukan  i) Uji Kualitas Data, ii) Uji Koefisien determinasi, iii) Uji Signifikansi simultan ( uji statistik T)  dan Uji Hipotesisi.  Alat analisis pengolahan data dengan menggunakan Analisis Regresi Linier Berganda Kesimpulan dari penelitian ini  adalah  aspek  kompensasi, kompetensi  dan  kepuasan  kerja   berpengaruh  secara signifikan   baik secara parsial  maupun simultan. Universitas Mercu Buana 2019-12-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6935 10.22441/jimb.v5i3.6935 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 3 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 207-214 2655-7274 2460-8424 10.22441/jimb.v5i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6935/2987 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/14499 2022-10-07T09:28:10Z jimb:ART driver

Effect Of Environmental Concern, Attitude, Subjective Norms, Perceived Behavioral Control And Availability On Purchase Of Green Skincare Products With Intention To Purchase As A Mediation Variable Ruslim, Tommy Setiawan Kartika, Yeni Hapsari, Claudia Gita Environmental Concern, Attitude, Subjective Norms, Intention to Purchase, Purchase of Green Skincare Products. The purpose of this study was to examine the effect of environmental concern, attitude, subjective norms, perceived behavioral control and availability on the purchase of green skincare products in Jakarta with intention to purchase as a mediating variable. Data analysis used Partial Least Squares-Structural Equation Modeling (PLS-SEM). This study used a purposive sampling method by distributing online questionnaires via google form to 180 respondents. The results showed that environmental concern, attitude and perceived behavioral control had a positive and significant effect on the intention to purchase green skincare products, while subjective norms and availability did not significantly affect the intention to purchase green skincare products. Intention to purchase green skincare products has a positive and significant influence on the purchase of green skincare products. Intention to purchase green skincare products can mediate the effect of environmental concern and attitude towards purchasing of green skincare products. Universitas Mercu Buana 2022-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14499 10.22441/jimb.v8i1.14499 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 1 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 120-137 2655-7274 2460-8424 10.22441/jimb.v8i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14499/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/19657 2023-11-30T15:11:24Z jimb:ART driver

The Effect of Work Stress, Organizational Commitment, and Job Satisfaction on Turnover Intention Syafaatun, Oktavia Yuliantini, Tine Job Stress, Organizational Commitment, Job Satisfaction, Turnover Intention This study aims to examine the effect of work stress, organizational commitment & job satisfaction on Turnover Intention at PT. Jakarta Aquarium. The population in this study were 117 employees, with a sample of 90, and 27 employees as trials in the instrumental test. The design of this study is quantitative causality, assisted by the PLS statistical method, and uses a Likerd measurement scale. Methods of data collection using survey methods, with the research instrument is a questionnaire. The techniques used in data collection are Library Research, Field Research, and saturated sampling. The results of this study prove that work stress has a significant positive effect on Turnover Intention, and organizational commitment and job satisfaction have a significant negative effect on Turnover Intention. Universitas Mercu Buana 2023-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/19657 10.22441/jimb.v9i1.19657 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 1 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 133-149 2655-7274 2460-8424 10.22441/jimb.v9i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/19657/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3703 2018-09-03T06:58:47Z jimb:ART driver

ANALISIS KEPUASAN PELANGGAN PLN SESUDAH MENJADI PELANGGAN LISTRIK PRABAYAR Viciwati, Viciwati Pulungan, Nur Aisyah F Kepuasan konsumen dianggap sebagai suatu tanggapan emosional pada evaluasi terhadap pengalamankonsumsisuatuprodukataujasa.Kepuasankonsumenmerupakanevaluasipembelidimanaalternatifyangdipilih sekurangkurangnya sama atau melampaui harapan pelanggan, sedangkan ketidakpuasan timbulapabila hasil tidak memenuhi harapan. Oleh karena itu perusahaan listrik negara dalam memberikankepuasan lebih terhadap pelayanannya haruslah selalu memperbaiki dan mengevaluasinya, salah satunyaadalah dengan cara mengeluarkan Produk Baru yang berupa Listrik Prabayar. Hasil penelitian denganmenggunakan 100 responden, ternyata kepuasan pelanggan setelah menjadi pelanggan PLN Prabayartidaklah lebih memuaskan dibandingkan pada saat mereka masih menggunakan PLN Pascabayar, hal inimenunjukkan bahwa masih banyak perbaikan sistem dari PLN Prabayar baik dari sisi teknologi,administrasi, sumber daya manusia dan alam bahkan hingga penentuan harga akhir yang harus dilemparkemasyarakat, jika PLN tidak sanggup,maka kemungkinan perlu pihak lain untuk diberikan kesempatanuntukbekerjasamadalammemberikanproduklistrikdenganhargayanglebihekonomis. Universitas Mercu Buana 2016-07-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3703 10.22441/jimb.v2i2.3703 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 2 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 641-661 2655-7274 2460-8424 10.22441/jimb.v2i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3703/1912 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/582 2018-09-03T03:15:44Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/576 2018-09-03T02:57:19Z jimb:ART driver

PENGARUH DESTINATION IMAGE, TRAVEL MOTIVATION, DAN KUALITAS PELAYANAN TERHADAP KEPUASAN PENGUNJUNG (STUDI KASUS PADA WISATAWAN NUSANTARA MUSLIM DI PANTAI CARITA PANDEGLANG BANTEN) Astini, Rina Sulistiyowati, Indah This research aims to know influence of destination image, travel motivation, and service quality on visitor satisfaction. The object for this research is Carita Beach Pandeglang - Banten. The study sample consisted of 150 respondents. The sampling technique in this research is Convinience Sampling, using a type of causal research. Hypothesis testing using Structural Equation Modeling (SEM). The result of this research shows that travel motivation and service quality has the significant influence toward customer satisfaction, while the destination image has not influence toward visitor satisfaction. It is has been proven form the result of hypothesis test that have been result on LISREL 8.70 program also showed a significant influence of the two variables and the negative value of one variable. Therefore, the accepted assumption is, there is two independent variables which supports the hypothesis and one independent variable that not support the hypothesis. Keywords: destination image, travel motivation, servic quality, visitor satisfaction. Universitas Mercu Buana 2016-05-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/576 10.22441/jimb.v1i3.576 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 3 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 337-347 2655-7274 2460-8424 10.22441/jimb.v1i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/576/504 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/26358 2025-04-10T02:03:31Z jimb:ART driver

The Personal Finance Behavioral: Digital Finance, Financial Knowledge And Financial Attitudes (Study on Mercu Buana University Students) Saputri, Ayu Laynda Risman, Asep Digitalization has become the factor to sustainable economic growth, every country including Indonesia continues to encourage digitalization in all sectors. The development of technology whose function is for transactions from various economic activities carried out by Mercu Buana University students, this study aims to analyze the influence of digital finace, financial knowledge, and financial attitudes towards financial behavior in Mercu Buana University students. To obtain data in this study by distributing questionnaires to students with a total of 100 respondents, with data analysis carried out using Partial Least Square (PLS) software. This research proves that funds show that digital finance has a positive effect on student financial behavior. And financial knowledge positively influences financial behavior and financial attitudes positively also influence financial behavior. Universitas Mercu Buana 2025-04-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/26358 10.22441/jimb.v11i1.26358 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 1 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 53-63 2655-7274 2460-8424 10.22441/jimb.v11i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/26358/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/24866 2024-03-31T13:30:50Z jimb:ART driver

Design, Play, Procure : Unleashing Gamification’s Potential To Reshape The Interior Design Business Model And Facilitate Direct Interior Furnishing Procurement Saputra, Augustine Sally Rustiadi, Sonny Gamification, User perceptions, Value co-creation, Technology acceptance model, Theory of planned behavior This mixed methods research explored user perceptions and engagement dynamics surrounding a proposed gamification concept for interior design and interior furnishing procurement. A multi-phase approach combining exploratory qualitative and quantitative methods with Technology Acceptance Model (TAM), Theory of Planned Behaviour (TPB) and Value Co-Creation (VCC) constructs. Thematic analysis from exploratory qualitative interviews revealed perceived benefits around enhanced collaboration, customization, and engagement, with expectations for effortless spatial visualization and creative experimentation. However, adoption outlook varied across age groups. Exploratory quantitative analysis using PLS-SEM showed perceived usefulness and social influences driving favorable attitudes, while confirmatory quantitative analysis with MRL constructs using CFA and PLS-SEM demonstrated positive early experiences markedly influencing eventual user advocacy. Key Recommendations center on agile, human-centric implementation focused on participative value creation for sustained relevance. Blended physical-digital strategies addressing category-specific barriers are advised, alongside participative value co-creation sustaining designer and client creativity amid digitization. While findings provide measured optimism given strong receptivity and adoption readiness metrics, targeted transition sequencing grounded in user realities, not technical proficiency alone, is imperative for contextually synchronized platform assimilation. Through meticulous multi-method inquiry, this pragmatic research elucidates requisite considerations around human-centric innovation for sustainable industry evolution. Universitas Mercu Buana 2024-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/24866 10.22441/jimb.v10i1.24866 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 1 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 15-37 2655-7274 2460-8424 10.22441/jimb.v10i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/24866/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/24866/5732 Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6841 2019-09-05T10:07:57Z jimb:ART driver

EFEKTIVITAS PELATIHAN KARYAWAN DAN PENGGUNAAN MEDIA SOSIAL PADA KINERJA USAHA KECIL DAN MENENGAH DI PROVINSI DKI JAKARTA Granita, Widya Safarini, Yamiati teknologi digital, sosial media, pelatihan karyawan, kinerja Peran strategis Usaha Mikro, Kecil dan Menengah (UMKM) dalam pertumbuhan ekonomi di Indonesia sangat penting, tidak hanya dalam hal penyerapan tenaga kerja tetapi juga distribusi produk. Teknologi informasi dan komunikasi telah digunakan untuk memperluas pangsa pasar dan meningkatkan daya saing UMKM. Di era revolusi industri 4.0, UMKM harus terus berinovasi dengan mendorong tumbuhnya marketplace baru yang menjadi kanal penjualan dan memaksimalkan pemasaran produk-produk UMKM. Penggunaan media sosial dapat meningkatkan kinerja industri yang bergerak pada skala usaha kecil dan menengah. Untuk itu diperlukan sumber daya manusia yang memiliki keahlian seiring perkembangan teknologi digital yang dinamis. Pelatihan yang diadakan oleh organisasi akan meningkatkan kemampuan dan pengetahuan karyawan dan berpengaruh positif terhadap performa kerja karyawan dan organisasi itu sendiri. Berbasis pada pemikiran penerimaan dan penggunaan teknologi digital serta program pelatihan karyawan, penelitian ini berupaya untuk menelaah interaksi efektivitas pelatihan karyawan dan penggunaan media sosial terhadap kinerja UMKM. Data primer diperoleh dari penyebaran kuesioner pada karyawan UMKM di propinsi DKI Jakarta. Pelaku bisnis UMKM diharapkan dapat memahami peran penting dari pelatihan karyawan dan penggunaan media sosial sebagai salah satu kanal penjualan dan komunikasi pemasaran serta faktor-faktor yang mempengaruhi kinerja UMKM, sehingga dapat menjadi motor penggerak keberhasilan dalam peningkatkan pendapatan Universitas Mercu Buana 2019-09-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6841 10.22441/jimb.v5i2.6841 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 2 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 226 - 248 2655-7274 2460-8424 10.22441/jimb.v5i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6841/2878 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/12180 2021-11-30T15:43:04Z jimb:ART driver

Exploring Factors Affecting The Auditor’s Organizational Commitment in The Government Organization Triyani, Indah Saratian, Eko Tama Putra Quality of Work Life; Role Conflict; Job Satisfaction; Organizational Commitment This study aims to analyze the influence of Quality of Work Life, Role Conflict and Job Satisfaction on Auditor’s Organizational Commitment in the Government Organization. The populations in this study were 80 Auditors of Government Organization. The sample used was 80 respondents in the division of the Deputy State Accountant in the Government Organization. The sampling method uses saturated sampling technique. Design of this research is quantitative method with questionnaires for data collection. This research using Structural Equation Modeling with Part Least Square (SEM-PLS) version 3.0. The results of the research shows that Quality of Work Life has a positive and significant effect on Organizational Commitment, Role Conflict has a not significant negative effect on Organizational Commitment, and Job Satisfaction has a positive and significant effect on Organizational Commitment. This research will contributed to institutions particularly in the Human Resources Division. Further researchers can also conduct research with the object of the Auditor in private institutions, so that the results can be compared. Universitas Mercu Buana 2021-11-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12180 10.22441/jimb.v7i3.12180 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 3 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 406-424 2655-7274 2460-8424 10.22441/jimb.v7i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12180/4945 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/15616 2022-12-15T10:40:39Z jimb:ART driver

The Influence of Costs, Long at Sea and Prices on Fishermen's Income in Alor District Sau Sabu, Junius Menase Sofyan, Maryanti Cost; Length of Sea; Price; Income The purpose of this study was to determine the effect of cost, duration of fishing and price on income. The methodology of this research is multiple linear regression with quantitative methods and uses primary data with data collection techniques: observation, interviews, questionnaires and literature study. The data is then processed with the help of SPSS 25. The analysis technique is preliminary analysis, namely: descriptive statistics, instrument tests and classical assumption tests, then followed by further analysis, namely analysis of the coefficient of determination and hypothesis testing, namely t-test and F-test. The results of this study are: ( 1) Partially, costs have an effect on income with a significance value of 3.5% < 5%. (2) Partially the length of time at sea has an effect on income with a significance value of 0% < 5%. (3) Partially the price has an effect on income with a significance value of 0% < 5%. (4) Simultaneously cost, length of fishing and price affect income with a significance value of 0% < 5%. The conclusions of this study are: 1) the results of the study accept H1, H2, H3 and H4. Universitas Mercu Buana Yayasan Tribuana Alor 2022-12-15 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15616 10.22441/jimb.v8i3.15616 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 3 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 401-407 2655-7274 2460-8424 10.22441/jimb.v8i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15616/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/37628 2026-04-04T08:45:13Z jimb:ART driver

The Impact of Macroeconomic Variables on the Performance of the SRI-KEHATI Index on the Indonesia Stock Exchange (2017–2024) Albab, Muhammad Ulul Sustainable Investment Index, Inflation, Interest Rate, Exchange Rate, Gross Domestic Product This study investigates the impact of selected macroeconomic indicators on the performance of the SRI-KEHATI Index in Indonesia during the 2017–2024 period. The explanatory variables consist of inflation, the policy interest rate, the rupiah to US dollar exchange rate, and gross domestic product (GDP), while the dependent variable is the SRI-KEHATI Index return. Employing a quantitative approach, the research applies a time series regression framework, preceded by stationarity diagnostics and supported by classical assumption tests to ensure statistical validity. Data were obtained from authoritative sources including Bank Indonesia, Statistics Indonesia, and the Indonesia Stock Exchange. The empirical results indicate that the exchange rate has a significant negative effect on the index performance, suggesting that rupiah depreciation tends to weaken sustainable stock returns. Conversely, inflation, interest rates, and GDP are found to have no statistically significant impact on the index within the observed period. These findings highlight the strategic importance of exchange rate stability in shaping sustainability-oriented investment strategies and provide valuable insights for policymakers, investors, and corporations seeking to strengthen their commitment to environmental, social, and governance (ESG) principles in the Indonesian capital market. Universitas Mercu Buana 2026-04-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/37628 10.22441/jimb.v12i1.37628 Jurnal Ilmiah Manajemen dan Bisnis; Vol 12, No 1 (2026): Jurnal Ilmiah Manajemen dan Bisnis; 18-37 2655-7274 2460-8424 10.22441/jimb.v12i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/37628/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/37628/9600 Copyright (c) 2026 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/4396 2018-11-19T06:48:35Z jimb:ART driver

PENGARUH KNOWLEDGE CREATION, KNOWLEDGE SHARING DAN KNOWLEDGE APPLICATION TERHADAP PEMBERDAYAAN KARYAWAN TETAP NON DOSEN (STUDI PADA UNIVERSITAS MERCU BUANA) Zumali, Zumali Suharyadi, Suharyadi S.K, Purwanto Knowledge Management; Knowledge Creation; Knowledge Sharing; Knowledge Application; Pemberdayaan; Penelitian ini bertujuan untuk mengetahui pengaruh proses knowledge management yang terdiri dari knowledge creation, knwoledge sharing dan knowledge application terhadap pemberdayaan karyawan tetap non dosen (Studi pada Universitas Mercu Buana). Desain penelitian yang digunakan adalah kuantitatif dan deskriptif. Populasi penelitian meliputi seluruh karyawan tetap non dosen pada Universitas Mercu Buana Jakarta. Jumlah sampel yang ditetapkan sebesar 116 responden dengan menggunakan metode sampel proporsional. Data penelitian dikumpulkan dengan menyebarkan kuesioner untuk memperoleh data yang dibutuhkan. Teknik pengujian data meliputi uji instrumen dan uji asumsi klasik. Metode analisis data yang digunakan adalah metode analisis regresi linear berganda, uji t, uji f, uji koefisien determinasi (R2) dan analisa korelasi antar dimensi dengan bantuan program SPSS 23.0 for windows. Hasil penelitian menunjukkan bahwa knowledge creation, knowledge sharing dan knowledge application berpengaruh positif signifikan secara simultan terhadap pemberdayaan karyawan. Knowledge creation tidak berpengaruh secara parsial terhadap pemberdayaan karyawan, sedangkan knowledge sharing dan knowledge application berpengaruh positif signifikan secara parsial terhadap pemberdayaan karyawan. Dimensi kombinasi pada variabel knowledge creation berkorelasi sedang dengan kepercayaan, dimensi koleksi pada variabel knowledge sharing berkorelasi kuat dengan percaya diri dan dimensi mekanisme pada knowledge application berkorelasi kuat dengan percaya diri. Penelitian selanjutnya disarankan menambah variabel lain dari proses knowledge management yang belum digunakan dengan object atau populasi yang berbeda. Universitas Mercu Buana 2018-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4396 10.22441/jimb.v4i1.4396 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 1 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 1-20 2655-7274 2460-8424 10.22441/jimb.v4i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4396/2161 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/9283 2020-12-15T10:40:37Z jimb:ART driver

PENGARUH LEVERAGE, ORIENTASI EKSPOR, DAN UKURAN PERUSAHAAN TERHADAP PROFITABILITAS PERUSAHAAN DALAM INDUSTRI BARANG KONSUMSI DI INDONESIA Ferranti, Putri Andari Leverage; profitabilitas; ekspor; ukuran perusahaan Penelitian ini bertujuan untuk mencari tahu tentang hubungan antara profitabilitas perusahaan dengan tingkat leverage, orientasi ekspor, dan ukuran perusahaan pada perusahaan-perusahaan dalam sektor industri barang konsumsi di pasar modal Indonesia. Metode yang digunakan adalah analisa deskripsi, uji-t, dan regresi berganda. Hasil yang ditemukan secara garis besar mendukung teori pecking order, dimana perusahaan lebih memilih mengambil sumber dana internal terlebih dahulu ketika profitabilitas mencukupi, diindikasikan dengan pengaruh negatif tingkat leverage kepada profitabilitas perusahaan. Orientasi ekspor perusahaan memiliki bukti lemah dalam memperkuat hubungan ini. Universitas Mercu Buana 2020-12-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/9283 10.22441/jimb.v6i3.9283 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 3 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 371 - 383 2655-7274 2460-8424 10.22441/jimb.v6i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/9283/4000 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/9283/1449 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3527 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/563 2018-08-25T04:29:54Z jimb:ART driver

A KNOWLEDGE MANAGEMENT APPROACH FOR SMALL MEDIUM ENTERPRISES (SME) Simorangkir, Rona Tumiur Mauli Caroline This paper was written to help identify some contradictions which can be found in the notion of knowledge management.  The author suggests that knowledge – that is to say “what we know” – can scarcely be understood and managed even by ourselves, much less by means of sophisticated information and communications (example: groupware and shareware) technologies. This paper examine the relationship between sustainable sales growth and knowledge management activities in small and medium sized enterprises (SMEs). this paper explores whether knowledge management has an influence on corporate success in small- and medium-sized enterprises (SMEs). Keyword : Management, Information, Communications, Relationship Universitas Mercu Buana 2016-05-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/563 10.22441/jimb.v1i1.563 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 1 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 58-85 2655-7274 2460-8424 10.22441/jimb.v1i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/563/494 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/29789 2024-12-05T03:27:30Z jimb:ART driver

The Analysis of Digital Based Creativity and Innovation of MSMEs in Bekasi City Santoso, Teguh Firmansyah, Ade Sudarwanto, Sudarwanto Creativity, Innovation, Digital, MSMEs, Marketing This research aims to determine the analysis of digital-based creativity and innovation of MSMEs  in Bekasi City. This study is a descriptive-qualitative approach. Data collection techniques used interview, observation and documentation methods. Determination of informants based on MSME owners in Bekasi City. The results of the study indicate that digital-based creativity is the main factor that allows MSMEs in Bekasi City to produce innovative solutions in facing competitive business challenges. In addition, digital-based innovation provides better competitiveness in the market through the implementation of creative ideas in business practices. Digital-based marketing strategy using the 7P marketing mix: product, price, place, promotion, people, process, physical evidence on MSMEs in Bekasi city in the form of online stores in the marketplace to reach buyers in various regions and abroad. The obstacles for MSME actors in Bekasi city is that there is no team that focuses on implementing digital marketing. Efforts made by MSME actors in Bekasi city that they are actively participating in digital marketing training organized by government agencies or other parties. Universitas Mercu Buana 2024-12-04 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/29789 10.22441/jimb.v10i3.29789 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 3 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 352-361 2655-7274 2460-8424 10.22441/jimb.v10i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/29789/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/16260 2022-12-15T10:40:39Z jimb:ART driver

How Safety and Accessibility Affect The Perception and Local Tourist Experience?: Eastern Indonesia Marine Tourism Pre- Covid-19 Pandemic Rahantoknam, Meyske Angel Marine Tourism, Tourist, Kei Islands, path analysis, accessibility Eastern Indonesia has enormous marine tourism potential. The main problem is accessibility. Inside the region also poses the same problem, where some local marine tourism spots can be considered accessible. In addition, the lack of infrastructure on marine tourism spots may actually have great impact on safety of tourist, which can all together affect the tourist positive experience. Based on this current condition, this study aimed to measure the impact of accessibility and safety through brand perception to tourism experience. This Study conducted In Kei Islands, which home of up and coming marine tourism spots in the country. This study used path analysis with Smart-PLS, questionnaire is used for data collection with total 120 samples. The result indicated that safety and accessibility have positive and significant effect on tourist experience, what is more, accessibility have positive and significant effect on marine tourism spot’ brand perception. This study clearly indicated that access to marine tourism spot can have a bigger impact to visitor positive experience and the brand image perception of the tourism spot, therefore tourism management with government to optimize the transportation and information related to make it easier for local, domestic and foreign tourists to visit the region.  Universitas Mercu Buana - 2022-12-15 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/16260 10.22441/jimb.v8i3.16260 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 3 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 307-318 2655-7274 2460-8424 10.22441/jimb.v8i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/16260/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/16260/3308 Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/18126 2023-12-07T03:09:20Z jimb:ART driver

The Effect of Environmental Concern, Attitude, Green Brand Knowledge, Green Perceived Value on Green Purchase Behavior with Green Purchase Intention As A Mediating Variable on Green Beauty Products Vania, Clarissa Ruslim, Tommy Setiawan Environmental Concern, Attitude, Green Brand Knowledge, Green Perceived Value, Green Purchase Intention As time goes by, the beauty industry continues to develop, such as the idea of sustainable beauty. Therefore, it is important for brands to increase consumer purchases in order to compete. The purpose of this study is to examine the effect of environmental concern, attitude, green brand knowledge, green perceived value on green purchase behavior with green purchase intention as a mediating variable on green beauty products. The sample in this study amounted to 236 respondents who were collected with purposive sampling technique to consumers of “TBS” products in Jakarta. Testing the research hypothesis was carried out using the PLS-SEM method. The results of this study indicate that environmental concern, attitude, green brand knowledge, green perceived value have a positive and significant influence on green purchase intention. Green purchase intention was found to have a positive and significant influence on green purchase behavior. In addition, green purchase intention can also positively and significantly mediate the influence between environmental concern and attitude towards green purchase behavior on green beauty products. Universitas Mercu Buana 2023-12-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/18126 10.22441/jimb.v9i3.18126 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 3 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 325-340 2655-7274 2460-8424 10.22441/jimb.v9i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/18126/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5625 2019-12-12T10:28:12Z jimb:ART driver

Pengaruh Kinerja Keuangan terhadap Harga Saham dengan Metode Diskriminan Springate pada Industri Migas di Pasar Saham Indonesia Arief, Harefan Capital loss, harga saham, Model Diskriminan Springate, Rasio keuangan Latar belakang penelitian ini adalah bagaimana perubahan harga saham selalu menjadi perhatian utama bagi setiap investor bila dibandingkan dengan pembayaran dividen oleh emiten, karena tingkat pengembalian yang berasal dari pergerakan pasar modal dapat memberikan hasil yang sangat tinggi, dan dapat berlangsung kapan saja (menit dan jam) atau pada hari hari kedepannya.. Meski secara signifikan juga memungkinkan investor bisa menderita kerugian (capital loss) ketika melakukan transaksi di pasar modal.Kinerja perusahaan yang tinggi akan berimplikasi pada harga saham perusahaan yang juga akan tinggi di pasar saham. Tujuan dari hasil penelitian ini adalah untuk mengidentifikasi dan menganalisa factor fundamental yang diwakili oleh rasio keuangan menggunakan model Diskriminan Springate terhadap pergerakan harga saham sector pertambangan di Bursa Efek Indonesia. Data yang digunakan adalah data perusahaan sector pertambangan Sub sector Minyak dan Gasdi BEI selama tahun 2013-2017.Berdasarkan hasil perhitungan di dapat hanya 2 variabel yang berpengaruh terhadap Harga Saham yaitu Variabel Rasio Laba ditahan terhadap Total Asset.dan variabel Rasio Sales terhadap Total Asset dan secara simultan semua variabel tidak berpengaruh terhadap harga saham Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5625 10.22441/jimb.v5i1.5625 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 1 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 53 - 61 2655-7274 2460-8424 10.22441/jimb.v5i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5625/2564 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/11902 2021-11-30T15:43:04Z jimb:ART driver

Analysis Of Factors That Determine Continuance Intention In Using Shopee Application During The Pandemic Covid-19 Indrawati, Indrawati Shaina, Nabila Ayu Consumer Behavior;Continuance Intention The Covid-19 pandemic has made people spend more time in the digital space for work, communicating, shopping, or just looking for entertainment. Many people end up shopping from home using e-commerce to buy their daily needs. Shopee is one of the e-commerce sites in Indonesia that has won first place with the most visits and the number of transactions has continued to increase, especially during the Covid-19 period. This shows that there has been a change in user interest in adopting the Shopee application. This study aims to analyze the factors that influence Continuance Intention in using the Shopee application. The theoretical approach used in this study is the UTAUT 2 model because the research model has the strongest predictive value. The research data collection was carried out by distributing online questionnaires via Google Form to 400 respondents. This study was tested with PLS-SEM as a technique for analyzing 8 research constructs from the modified UTAUT2 model. The results showed that the factors that influenced the Continuance Intention in adopting the Shopee application from the highest to the lowest were Social Influence, Hedonic Motivation, Habit, Trust, and Performance Expectancy. This model is proven to strongly predict the desire of consumers to continue to adopt the Shopee application in the future because the R² in the study is 74.1%. The influence of the age moderating variable in this study does not affect the Continuance Intention of consumers in adopting the Shopee application. While the influence of the moderating variable gender affects the Trust variable on Continuance Intention. Universitas Mercu Buana 2021-11-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11902 10.22441/jimb.v7i3.11902 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 3 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 294-311 2655-7274 2460-8424 10.22441/jimb.v7i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11902/4938 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/33965 2025-12-04T03:24:26Z jimb:ART driver

Exploring Consumer Behavior in Coffee Shops: How Store Atmosphere and Sustainability Marketing Affect Purchase Intentions through Perceived Value Dirgandana, Ghaqa Tamara, Dewi Store Atmospherics; Sustainability Marketing; Purchase Intention; Perceived Value; Coffee Shops Recent years, academic and practical attention toward store atmospherics has grown, driven by its consideraable impact on consumer behavior. Simultaneously, sustainability has emerged as a prominent topic across various industries, including the culinary sector. This study investigates how store atmosphere and sustainable marketing practices affect consumer purchase intention, emphasizing the mediating role of perceived value, specifically in the context of coffee shop consumption behavior in Indonesia. Data were collected via an online survey targeting frequent local coffee shop visitors, yielding 200 respondents through convenience sampling. The study utilized the Partial Least Squares Structural Equation Modeling (PLS-SEM) technique for analysis, with SmartPLS 3.0 software serving as the primary analytical tool. The dependent variable is purchase intention, while the independent variables comprise store atmosphere and sustainability marketing, with perceived value functioning as an intermediary factor in the model. The results indicate, first, that a significant and positive effect is exerted by store atmosphere on consumers’ purchase intention. Second, sustainability marketing does not demonstrate a direct and statiscally notable influence on consumers' buying decisions. Finally, Perceived value serves as a crucial intermediary in the linkage between store atmospherics, sustainability marketing, and purchase intention within Indonesian coffee shops. Universitas Mercu Buana 2025-11-29 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33965 10.22441/jimb.v11i3.33965 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 3 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 278-292 2655-7274 2460-8424 10.22441/jimb.v11i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33965/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3835 2018-09-08T02:02:27Z jimb:ART driver

DAY OF THE WEEK EFFECT DAN WEEK FOUR EFFECT TERHADAP RETURN SAHAM LQ-45 DI BURSA EFEK INDONESIA Pulungan, Nur Aisyah F. Murni, Yanti Mansyur, Hirdinis Return Saham; Day of The Week Effect; Week Four Effect; Penelitian ini dilakukan dengan tujuan untuk menguji dan menganalisis terjadinya hari perdagangan(the day of the week effect) dan minggu keempat (week four effect) pada return saham di Bursa EfekIndonesia. Sampel dalam penelitian ini adalah perusahaan-perusahaan yang terdaftar sebagai saham LQ-45selama bulan Februari 2013-Januari 2014. Jenis data yang dipakai merupakan data sekunder yang berupadata laporan keuangan perusahaan yang menjadi sampel selama Februari 2013-Januari 2014 dalam bentukdata harian. Metode yang digunakan untuk menganalisis dengan menggunakan analisis deskriptif dan regresilinier berganda tanpa intercept (multiple regression through origin) dengan menggunakan SPSS 16 dan untuk menguji kebenaran hipotesis menggunakan statistik t (uji t). Hasil penelitian menunjukkan bahwa hariperdagangan berpengaruh signifikan terhadap return saham LQ-45 di Bursa Efek Indonesia dan hari seninminggu keempat dan kelima tidak berpengaruh terhadap return saham LQ-45 yang terendah pada hari senindi Bursa Efek Indonesia. Universitas Mercu Buana 2016-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3835 10.22441/jimb.v2i3.3835 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 3 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 855-863 2655-7274 2460-8424 10.22441/jimb.v2i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3835/2008 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3979 2019-07-05T15:33:14Z jimb:ART driver

KEPUASAN DAN LOYALITAS PELANGGAN MY PERMATA WISATA :SERVQUAL MODEL Hamdan, Hamdan bentuk fisik; daya tanggap; empati; jaminan; kepuasan; loyalitas; responsif Penelitian ini bertujuan untuk menganalisis dimensi kualitas pelayanan yang mempengaruhi kepuasan dan implikasinya terhadap loyalitas pelanggan My Permata Wisata. Pemilihan dan pengambilan sampel menggunakan teknik systematic random sampling dan quota sampling dari 162 peserta wisata. Metode analisa data menggunakan Structural Equation Modeling (SEM) dengan program Linear Structural Relations (LISREL). Hasil penelitian ini menunjukkan bahwa bentuk fisik dan empati berpengaruh singnifikan terhadap kepuasan, sementara kepuasan berpengaruh terhadap loyalitas pelanggan secara signifikan. Sedangkan responsif, keandalan dan jaminan tidak mempunyai pengaruh signifikan terhadap kepuasan. Potensi sektor pariwisata memiliki peluang besar dalam mendorong pertumbuhan ekonomi Indonesia ke depannya. Oleh karena itu, kejelasan kinerja pelayanan My Permata Wisata dapat diimplementasikan dalam pengambilan keputusan strategi pemasaran ke depannya, sehingga menjadikan perusahaan terus tumbuh dan berkelanjutan ke depannya. Universitas Mercu Buana 2018-11-14 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3979 10.22441/jimb.v4i2.3979 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 2 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 198-214 2655-7274 2460-8424 10.22441/jimb.v4i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3979/2241 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/8267 2020-12-15T10:49:05Z jimb:ART driver

PENGARUH ETNOSENTRISME, CITRA MEREK DAN GAYA HIDUP TERHADAP KEPUTUSAN PEMBELIAN BATIK Fauzi, Firman This study aims to analyze the influence of ethnocentrism, brand image and lifestyle on batik purchase decision. Population in this study are consumers in the West Jakarta area. The sample used was 150 respondents, calculated based on the Hair formula. The sampling method of respondent used in this study is through convenience sampling. Data collection methods using survey methods, with the research instrument is a questionnaire. Analysis’s system that used is a statistic analysis as multiple linear regression tests with SPSS version 23 application. The results of this study indicate that partially ethnocentrism and lifestyle have a positive and significant effect on batik purchase decision. While the brand image has a positive effect, but not significantly to the batik purchase decision. Universitas Mercu Buana 2020-07-27 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8267 10.22441/jimb.v6i2.8267 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 2 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 236 - 253 2655-7274 2460-8424 10.22441/jimb.v6i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8267/3601 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3682 2018-09-03T02:31:05Z jimb:ART driver

KAUSALITAS HARGA SAHAM DAN KURS USD/IDR Risman, Asep exchange rate; stock prices; granger causality test; lag; Theoretically Correlation exchange rate on stock prices, there is the relationship (negative) associated withthe performance of the issuer and economic conditions, there is also the approach that shows therelationship because of the behavior of foreign investors related to the investment portfolio, but there isalso approach that states no direct relationship. Likewise, previous studies showed a negative relationshipbeetween stock prices and exchange rates, but there is also research showing that the relationshipsignificant or under certain conditions, and the more extreme results showed no relationship betweenstock prices and exchange rates.In this study, we just want to prove which variable affect other variableswhether the exchange rate affect the price of the stock or just the opposite, based on test granger causality shows stock prices and the exchange rate of USD / IDR turns affect each other, so that the analysis ofchanges in exchange rates can be used to predict the tendency towards the stock price, and vice versa, inaddition to stock price changes are not necessarily directly affect the exchange rate at that time, but ittakes time or lag. Universitas Mercu Buana 2015-06-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3682 10.22441/jimb.v1i2.3682 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 2 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 220-224 2655-7274 2460-8424 10.22441/jimb.v1i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3682/1894 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3501 2018-08-24T07:02:50Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/14305 2022-08-02T07:18:30Z jimb:ART driver

E-Commerce, Self Assessment System, Tax Knowledge And Automatic Exchange Of Information On Tax Avoidance Intentions Rista, Novi Aprilina, Vita Baryanto, Sugeng E-Commerce, Self Assessment System, Tax Knowledge, AEoI, Tax Avoidance This study aims to examine whether or not there is an effect of E-Commerce, Self Assessment System, Tax Knowledge and Automatic Exchange of Information (AEoI) on the Tax Avoidance Intentions of E-commerce Business Actors. The research method uses a quantitative approach. The data used are primary data by distributing questionnaires in the form of Google forms to e-commerce business people. The research population is e-commerce players in West Java Province as many as 1,820 e-commerce business people. Determination of the sample with the Slovin formula resulted in 100 respondents. The sampling technique is purposive sampling with data analysis using Multiple Linear Regression. The results of this study indicate that Tax Knowledge has a positive effect on intention to avoid tax while E-Commerce, Self Assessment System and Automatic Exchange of Information (AEoI) have no effect on intention to avoid tax. Universitas Mercu Buana Novi Rista, Vita Aprilina, Sugeng Baryanto 2022-08-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14305 10.22441/jimb.v8i2.14305 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 2 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 191-202 2655-7274 2460-8424 10.22441/jimb.v8i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14305/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/14305/2774 Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/20524 2023-12-02T02:57:17Z jimb:ART driver

Investment Opportunity, Institutional Ownership, and Excess Cash Holdings with Financial Constraint as Moderation Putri, Indriana Rezkia Lantara, I Wayan Nuka Excess cash holdings, Investment Opportunity, Institutional Ownership, Financial constraint, robustness test This study examines the effect of investment opportunity and institutional ownership on excess cash holdings with financial constraint as the moderating variable. Holding more cash is often rated as a negative signal for shareholders, because of the probability to use the cash inappropriately and increase the agency cost. Another side, excess cash can give a good impact on the company when is more expensive to access the external financing, or the situation make the firm had financial constraints. This study uses excess cash holdings as a dependent variable with few references and a high chance for further research. Generalized least square (GLS) is employed to analyze the hypothesis with observations during 2015-2020 in listed companies on Indonesia Stock Exchange (IDX). The result of this research shows that investment opportunity has a positive influence on excess cash holdings. If there is a financial constraint, it will decrease the effect of Investment opportunity to the level of excess cash holdings. This study was unable to capture the impact of institutional ownership on excess cash holdings in constraint nor unconstraint firms. The study was robust enough when the proxy of excess cash changed and when using the lag variable to confirm the primary result. Universitas Mercu Buana a person 2023-08-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/20524 10.22441/jimb.v9i2.20524 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 2 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 191-203 2655-7274 2460-8424 10.22441/jimb.v9i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/20524/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/20524/4602 Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5612 2019-05-07T05:59:51Z jimb:ART driver

ANALISA KINERJA PDAM TIRTA KAHURIPAN, KABUPATEN BOGOR DENGAN PENDEKATAN BALANCED SCORECARD Gani, Abdul penilaian kinerja, perspektif pelanggan, proses bisnis internal. Hasil pengujian CFA (Confinmantory Factor Analysis) sebagaimana ditampilkan pada gambar berikut, bahwa nilai MSA (Measure of Sampling Adequacy) sebesar 0,731 lebih besar dari nilai yang disyaratkan sebesar 0,50 Hal ini dapat diambil kesimpulan bahwa jumlah sampel yang dilakukan adalah representatif. Sedangkan berdasarkan hasil uji realibilitas sebagaimana ditampilkan pada tabel dibawah ini terlihat nilai “ Cronbach’s Alpha nya sebesar 0,798. Hal ini menunjukan bahwa indicator/ variabel atas jawaban responden adalah “ handal/ realibel” atau stabil. Bahwa hasil pengolahan data kinerja Perspektif Pelanggan secara total dinilai kinerja kepuasan pelanggan PDAM Tirta Kahuripan Bogor dinilai Cukup Baik. Hal ini dilihat dari total indeks kepuasan pelanggan mencapai 3,24. Kinerja tersebut diperoleh dari aspek i) Kulitas Produksi, ii) Distribusi, iii) Rekening Air, iv) Meter Air dan v) Aspek Pelayanan Pengaduan. Responden memberikan nilai tertinggi pada Indeks aspek pelayana Rekening Air (3,61) dan Nilai indeks terendah responden menilai pada Aspek Pengaduan Pelayanan Pelanggan (3,24). Bahwa berdasarkan data penambahan jumlah sambungan baru dibandingkan dengan total sambungan, dapat kita simpulkan bahwa kemampuan PDAM dalam menjaring pelanggan baru PDAM Kabupaten Bogor cukup baik . Hal ini dilihat dari adanya peningkatan jumlah sambungan air minum yaitu 8.698 sambangan baru di tahun 2014 dan menjadi 11.111 sambungan pada tahun 2015 atau tingkat kemampuan menarik sambungan baru mencapai 8,34%. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5612 10.22441/jimb.v4i3.5612 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 3 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 338 - 345 2655-7274 2460-8424 10.22441/jimb.v4i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5612/2553 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/12275 2021-07-30T16:25:49Z jimb:ART driver

THE INFLUENCE OF CURRENT RATIO, RETURN ON ASSET, DEBT TO EQUITY RATIO AND GOOD CORPORATE GOVERNANCE ON MARKET VALUE ADDED (EMIPICAL STUDY ON BASIC INDUSTRY AND CHEMICAL COMAPNIES LISTED ON INDONESIA STOCK EXCHANGE) Mareta, Sigit Anggraini, Wahyu Current Ratio, Return on Asset, Debt to Equity ratio, Good Corporate Governance, Market Value Added. The purpose of this research is to determine the influence of Current Ratio, Return on Asset, Debt to Equity ratio and, Good Corporate Governance on Market Value Added. The population used in this study is the basic industry and chemical companies listed on the Indonesia Stock Exchange within 2014-2016 with a total of 25 companies. The research used purposive sampling method. The method of purposive sampling and regression analysis logistics, are use for election sample. The variable Market Value Added and Good Corporate Governance are measured by dummy and other variables as CR, ROA and DER measured by the ratio.The results show that current ratio and debt to equity ratio has a significant influence on Market Value Added, while Return on Assets and Good Corporate Governance doesn't. Universitas Mercu Buana 2021-07-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12275 10.22441/jimb.v7i2.12275 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 2 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 189-196 2655-7274 2460-8424 10.22441/jimb.v7i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12275/4648 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3550 2018-08-25T05:35:19Z jimb:ART driver

FINANCIAL PERFORMANCE ANALYSIS AND EVALUATION OF PALM OIL AGROINDUSTRY: AN INDONESIA EXPERIENCE Daryanto, Wiwiek Mardawiyah Financial health condition; financial ratios; SOEs; CPO; Indonesia is the world largest producer and exporter of crude palm oil (CPO). The export of CPO has increased by 46% from 15.1 million ton in 2008 became 27 million ton in2016. However, the value of the export decreased by 11.67%, from US$ 21.1 billions in2014 to US$ 18.64 billions in 2015. This was caused by the decrease of CPO export pricesignificantly (33.33%), from US$ 1,033/ton in 2008 to US$ 689/ ton in 2016. The DecreeNo.KEP-100/MBU/2002 issued by Indonesia Ministry of State-Owned Enterprises (SOEs)on June 2002 provides the mandatory of measuring and rating the financial healthcondition of SOEs. This study aims to analyze and evaluate the financial health conditionof three Palm Oil SOEs under Indonesia Ministry of Agriculture: (1) PT PerkebunanNusantara I; (2) PT. Perkebunan Nusantara III; (3) PT. Perkebunan Nusantara IV forperiodsof 2011 – 2015. The results of investigating of eight financial ratios: return onequity, return on investment, cash ratio, currentratio, collectionperiod, inventoryturnover,totalassetturnover, totalequity to totalasset, then be validated by the decree of the SOEsministry to conclude the financial health condition of the companies. The result shows thatthe three Palm Oil SOEs have achieved financial health condition levels with rank ratingsas follows: (1) PT. Perkebunan Nusantara IV (AA,AA,A,AA,BBB), (2) PT PerkebunanNusantara III (A,AA,A,BBB,BBB), and (3) PT Perkebunan Nusantara I(A,A,A,BB,CCC). Universitas Mercu Buana 2018-08-24 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3550 10.22441/jimb.v3i1.3550 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 1 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 112-130 2655-7274 2460-8424 10.22441/jimb.v3i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3550/1884 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3857 2018-09-10T02:58:30Z jimb:ART driver

STRATEGI PEMASARAN MELALUI IDENTIFIKASI FAKTOR PENTING YANG MEMPENGARUHI KONSUMEN MEMBELI MOBIL GREAT NEW XENIA DI WILAYAH JAKARTA SELATAN Soecahyadi, Soecahyadi Sari, Alvita Analisa Faktor; Great New Xenia; Strategi Pemasaran; Kondisi pasar otomotif yang bergejolak tidak menjadi kendala yang berarti untukpenjualan multi purposes vehicles (MPV) yang di bundel dengan harga lebih rendah.PT.Daihatsu Astra Motor Daihatsu memperkenalkan produk terbaru mereka Great New Xenia termasuk mobil kelas low dan mid-end. Tujuan dari penelitian ini adalah mendapatkanfaktor penting yang mempengaruhi konsumen dalam keputusan membeli mobil DaihatsuGreat New Xenia, serta menentukan strategi pemasaran yang tepat dalam rangkameningkatkan penjualan. Faktor penting yang menjadi minat konsumen dalam membeli mobil Daihatsu Great New Xenia adalah dinamakan faktor Features yang terdiri atas mobil yang memiliki fitur-fitur yang lengkap, desain keseluruhan sangat menarik, kemudahan dalam mengoperasikan kendaraan baik yang manual maupun yang matic serta kemudahan metode atau cara pembayaran yang ditawarkan dealer kepada para calon pembeli.Strategi pemasaran yang perlu dilakukan oleh PT. Astra Daihatsu Motor, Tbk dalam rangka meningkatkan penjualan adalah dengan Melakukan berbagai kegiatan promosi yang mengedepankan Features kendaraan. Universitas Mercu Buana 2018-09-10 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3857 10.22441/jimb.v3i3.3857 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 3 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 332-348 2655-7274 2460-8424 10.22441/jimb.v3i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3857/2025 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/7784 2020-12-15T10:48:43Z jimb:ART driver

PENGARUH HARGA, CITRA MEREK DAN KUALITAS LAYANAN TERHADAP KEPUTUSAN PEMBELIAN PRODUK ONLINE JAKMALL Stephani, Suzan Bernadetha Nashar, Muhammad harga, citra merek, kualitas layanan dan keputusan pembelian Jakmall adalah e-commerce (jualbeli) yang sedang berkembang di indonesia. Persaingan bisnis yang ketat antara e-commerce di Indonesia, membuat jakmall harus menindak lanjuti keluhan yang dirasakan oleh konsumen. Jika hal tersebut tidak cepat ditinda klanjuti ada kemungkinan konsumen akan beralih kepada pesaing. Penelitian bertujuan untuk mengetahui pengaruh harga, citra merek dan kualitas layanan mempegaruhi terhadap keputusan pembelian produk online jakmall. Metode pengambilan sampel dengan teknik purposive sampling, kuesioner disebarkan secara online kepada 125 responden. Analisis data menggunakan Partial Least Square (PLS), dengan menguji outer model, Inner model dengan tingkat signifikan 0,05 (5%) =1,96. Hasil penelitian menunjukkan bahwa variabel harga, citra merek, dan kualitas layanan bersifat positif dan signifikan terhadap sikap keputusan pembelian produk jak mall. Variabel terbesar yang mempegaruhi sikap konsumen atas pembelian produk online jakmall ialah variabel citra merek , karena konsumen merasakan banyak keuntungan yang diperlukan saat membeli produk jak mall Universitas Mercu Buana 2020-04-22 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7784 10.22441/jimb.v6i1.7784 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 1 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 125 - 144 2655-7274 2460-8424 10.22441/jimb.v6i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7784/3360 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3534 2018-09-03T04:11:29Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3696 2018-09-03T03:58:17Z jimb:ART driver

PERBANDINGAN PENILAIAN SAHAM DENGAN METODE ANALISIS FUNDAMENTAL DAN ANALISIS TEHKNICAL, PENGGORENGAN SAHAM, SERTA KEPUTUSAN PENILAIAN SAHAM JIKA HASIL BERLAWANAN ARAH UNTUK KEDUA METODE ANALISIS PADA SAHAM BAKRIE GROUP UNTUK PERIODE 2005- 2009 Harwaningrum, Miranti Analisis Fundamental; Analisis technical; penggorengan saham; keputusan penilain saham jika hasil berlawanan arah; Beberapa tahun belakangan ini, dunia investasi mengalami peningkatan. Hal ini dapat terlihat dari data rata-rata perdagangan saham yang dimiliki oleh Bapepam. Salah satu jenis instrumen investasi yang seringdiminati oleh investor adalah saham. Apabila dibandingkan dengan obligasi, saham memiliki expectedreturn yang lebih tinggi. Namun, saham memiliki resiko yang lebih tinggi bila dibandingkan denganobligasi. Untuk melakukan penilaian saham ada dua analisis yang dapat dilakukan, yaitu fundamentalanalysis dan technical analysis. Untuk menentukan harga saham yang tepat bagi sebuah perusahaan,terlebih dahulu harus memproyeksikan dividen dan earning yang diharapkan dari sebuah perusahaan.Inilah inti dari analisis fundamental, yaitu menentukan sebuah nilai perusahaan seperti earning yangdiharapkan (Bodie, Kane, Marcus, 2009). Analisis fundamental terbagi menjadi tiga bagian besar. Namundalam penelitian ini Analisis perusahaan akan menjadi fokus utama. Selain analisis fundamental, investordapat melakukan penilaian saham dengan menggunakan technical analysis. Analisis teknikal adalah teknikuntuk memprediksi arah pergerakan harga saham dan indikator pasar saham lainnya berdasarkan padadata pasar historis (Tandelilin, 2010). Analisis teknikal umumnya mencari pola yang terjadi berkali-kalipada harga saham (Bodie, Kane, Marcus, 2009). Permasalahan terjadi ketika analisis fundamental dananalisis teknikal tidak memberikan hasil yang searah tapi memberikan hasil yang berlawanan.Permasalahan ini yang akan dibahas oleh peneliti dan dikaitkan dengan beberapa perusahaan, yaitu SevenBrothers (Grup Bakrie). Universitas Mercu Buana 2016-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3696 10.22441/jimb.v2i1.3696 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 1 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 558-570 2655-7274 2460-8424 10.22441/jimb.v2i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3696/1906 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/27901 2025-09-16T01:32:53Z jimb:ART driver

The Review of Employee Rewards on Employee Motivation: Toxic Environment as a Moderating Variable Mdhlalose, Dickson Scotch Financial Rewards; Motivation; Non-Financial Rewards; Toxic Work Environment Research Aims: Employee rewards are a crucial tool for motivating employees and recognizing their contributions to the organization. However, organizations frequently overlook the elements (financial and non-financial rewards) that motivate employees. Most organizations lack the tools and tactics to motivate employees, and the worst part is that a toxic work environment demotivates employees. This study aims to investigate and understand how employees’ rewards affect their motivation in a toxic environment as a moderating variable. Design/Methodology/Approach: Exploratory research was used to approach this review. The information was gathered from online publications, dissertations, online databases, and books relevant to the topic. Research Findings and Implications: Financial benefits are the most effective motivator for most employees; however, select individuals are driven by intrinsic rewards. Money alone is not always sufficient to motivate employees. A toxic workplace environment demotivates employees regardless of the rewards. Theoretical Contribution/Originality: The importance of this research study is that it expands on the substantial amount of literature that is currently accessible concerning how employee rewards affect employee motivation. Research Limitation: The study's boundaries were limited to secondary sources that were easily accessible online, the impact of employee rewards on motivation, and related issues. Secondary sources may occasionally be out of date or inaccurately reflect the most recent techniques or technological advancements in the sector. Universitas Mercu Buana 2025-08-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/27901 10.22441/jimb.v11i2.27901 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 2 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 215-230 2655-7274 2460-8424 10.22441/jimb.v11i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/27901/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3516 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/25353 2024-08-08T16:56:37Z jimb:ART driver

Correlation of Terrestrial Satellite Computation and Allocation of Influence in The Development of Digital Television Services in Indonesia Rizky, Dede Nusraningrum, Dewi Bakhour, Alyssa Edwina Imad Khalid Mulyatri, Egit Dewi, Kayla Rosantya Analog television in Indonesia is currently being transformed into digital television. The purpose of this study was to determine the effectiveness and impact of the transformation of these changes. The total population of the study was unknown, so convenience sampling was used. The data obtained is processed descriptively. The results show that all respondents who earn below one million rupiah per month do not receive government assistance to convert their televisions into digital televisions, and respondents do not have knowledge about how to convert analog televisions into digital televisions. Universitas Mercu Buana 2024-08-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25353 10.22441/jimb.v10i2.25353 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 2 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 224-234 2655-7274 2460-8424 10.22441/jimb.v10i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25353/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5624 2019-12-12T10:28:12Z jimb:ART

KINERJA PERUSAHAAN DITINJAU DARI FAKTOR NON KEUANGAN DAN STRUKTUR MODAL Lestari, Diyan Wicaksono, Bambang Wahyudi Board Size, Dewan Komisaris Independen, Komite Audit, Kepemilikan Terkonsentrasi, Inovasi, Struktur Modal, Kinerja Penelitian ini bertujuan untuk menganalisa mengenai kinerja perusahaan makanan dan minuman yang terdaftar di Bursa Efek Indonesia dari periode tahun 2009 sampai dengan tahun 2016, ditinjau dari faktor non keuangan yang terdiri dari corporate governance yang diukur dengan Board Size, Dewan Komisaris Independen, Komite Audit, dan Kepemilikan Terkonsentrasi, serta inovasi yang merupakan salah satu faktor penunjang untuk meningkatkan kinerja. Struktur modal berperan penting dalam meningkatkan kinerja organisasi. Penelitian ini menggunakan regresi linear berganda dengan data panel. Hasil penelitian ini menunjukkan bahwa beberapa variable non keuangan dan struktur modal berpengaruh terhadap kinerja perusahaan Universitas Mercu Buana 2019-12-12 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5624 10.22441/jimb.v5i1.5624 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 1 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 44 - 52 2655-7274 2460-8424 10.22441/jimb.v5i1 id-ID Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/10592 2021-03-31T18:35:22Z jimb:ART driver

The Comparison of Dynamic Relationship between Sharia Stock Index and Composite Index with Macroeconomic Variables: A Case Study of Indonesia Sumarto, Agus Herta Sharia Stock Index, Composite Index, Dynamic Conditional Correlation This research analyses the dynamic relationship between sharia stock exchange (ISSI) and macroeconomics condition then it would be compared to the relationship of the composite stock exchange (IDX Composite Stock). The method used in this study is Dynamic Conditional Correlation (DCC) analysis. Based on DCC method, it seems that macroeconomic variable have changing pattern of correlation relationship. This changeable pattern is not only on value scale but until its number sign. It indicated that macroeconomic variable has not any significant impact on sharia stock index (ISSI) and IDX composite index and vice versa. Universitas Mercu Buana 2021-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10592 10.22441/jimb.v7i1.10592 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 1 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 49-63 2655-7274 2460-8424 10.22441/jimb.v7i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10592/4359 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/10592/1752 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3697 2018-09-03T06:58:47Z jimb:ART driver

PENGARUH PROMOSI TERHADAP BRAND IMAGE PADA PENGAMBILAN KEPUTUSAN MENJADI MAHASISWA UNIVERSITAS MERCU BUANA Hanafiah, Ali Kasmo, Arief Bowo Prayoga Promotion; Brand Image; Decision to be a student of UMB; Education Expo The purpose of this study was to examine the effect of promotion on brand image to decision to be astudentofUniversity ofMercu Buana.This research have limitation that focus on facultyofeconomicsandbusiness Regular Class in Campus Meruya. With a spread of 259 questionnaires where divided withproportional method are 138 (Management S1), 98 (AccountingS1), 9 (Management D3), 13 (AccountingD3). Based on the results of data processing with AMOS obtained evidence that there is a statisticallysignificantpositiveeffectbetweenPromotionwithBrand Image.Similarly,BrandImagewithDecisiontobeastudentofUniversityofMercuBuanaandPromotionwithDecisiontobeastudentofUniversityofMercuBuana. Moreover, descriptive statistic examine that mostly student of high school knows more about UMBfromattendedoneducationexpo. Universitas Mercu Buana 2016-07-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3697 10.22441/jimb.v2i2.3697 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 2 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 571-585 2655-7274 2460-8424 10.22441/jimb.v2i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3697/1907 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/587 2018-09-03T03:15:44Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/580 2018-09-03T02:57:19Z jimb:ART driver

EVALUASI DESAIN KEMASAN, POPULARITAS MEREK DAN BUDAYA KONSUMEN TERHADAP CITRA MEREK AQUA Tafiprios, Tafiprios Arbi, Rani This research aimed to analyze the influence of Packaging, Brand Awareness and Consumer Culture to Brand Image. The object of this research is consumer of Aqua in Jakarta. This research was done to 100 respondents by using accidental sampling technique and using the SPSS 22.00 program as a data processing. The result of this research shows that either simultaneouslyor partially, the variable of Packaging, Brand Awareness and Consumer culture influence the Brand Image of Aqua In Jakarta. It has been proven from the result of (f) simoultant test and the result of (t) partial shows significant point of three independent variables that supports the hipothesys. Therefore, the accepted assumption is, there is influence between Packaging, Brand Awareness, and Consumer Culture to Brand Image of Aqua in Jakarta. Keywords: packaging, brand awareness, consumer culture, brand image. Universitas Mercu Buana 2016-05-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/580 10.22441/jimb.v1i3.580 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 3 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 400-412 2655-7274 2460-8424 10.22441/jimb.v1i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/580/508 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/26098 2025-04-10T02:03:31Z jimb:ART driver

Financial and Macroeconomic Ratio Analysis Against Financial Distress Ariefah, Nuraini Hirdinis, Hirdinis Financial Distress; Profitability Ratios; Leverage Ratios; Liquidity Ratios; Activity Ratios This study aims to analyze the effect of financial ratios and macroeconomic factors on financial distress in trade, service and investment sector companies during the 2018-2021 period. The sampling method used a purposive sampling technique with a total sample of 58 companies. Testing was carried out using E-Views using the panel data regression analysis method. Financial distress is measured using the Altman Z-Score where the higher the value indicates the healthier the company. The results showed that the profitability ratios as measured by Return on Assets had a significant positive effect on financial distress. That is, the higher the Return on Assets, the healthier the company's finances. The leverage ratio as measured by the Debt-to-Equity Ratio has no significant effect on financial distress. The liquidity ratio as measured by the Current Ratio has a significant positive effect on financial distress. In addition, the activity ratio as measured by Total Asset Turnover has a significant negative effect on financial distress. That is, the higher the total asset turnover of a company, the more un-healthy the company's financial condition will be. The inflation variable as measured by the Consumer Price Index has no significant effect on financial distress in companies in the trade, service and investment sectors during the 2018-2021 period. Universitas Mercu Buana 2025-04-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/26098 10.22441/jimb.v11i1.26098 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 1 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 111-123 2655-7274 2460-8424 10.22441/jimb.v11i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/26098/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/26098/6094 Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3504 2018-08-24T07:02:50Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/25031 2024-03-31T13:43:43Z jimb:ART driver

Analysis of Organizational Culture Based on The Organizational Culture Assessment Instrument (OCAI) Mumtazah, Humaira Kadiyono, Anissa Lestari Ashriyana, Rezki organizational culture; Organizational Culture Assessment Instrument (OCAI); Tasikmalaya Institute The research aims to determine the current and expected culture at the Tasikmalaya City Institute. The research method used is descriptive quantitative, examining organizational culture variables. The instrument used is the OCAI (Organizational Culture Assessment Instrument) measuring instrument, which has been translated. Participants were 31 lecturers and staff. The findings of this research are that the culture currently occurring is a close clan culture characterized by high levels of kinship, collaboration, and prioritizing flexibility, commitment, and cooperation. Meanwhile, the culture expected to occur in the future is a hierarchical culture characterized by a more structured culture, having a formalized system, prioritizing strict, stable, consistent, and efficient control. The Institute can consider taking cultural change intervention steps to address these gaps. Universitas Mercu Buana 2024-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25031 10.22441/jimb.v10i1.25031 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 1 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 110-118 2655-7274 2460-8424 10.22441/jimb.v10i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25031/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/7177 2020-07-27T02:42:04Z jimb:ART driver

PENGARUH BEBAN KERJA DAN KOMPENSASI TERHADAP KEPUASAN KERJA KARYAWAN (Studi Kasus Pada Kantor PT. Tri Poda Parama) Paijan, Paijan Putri, Anugrah Hutami Beban Kerja, Kompensasi, Kepuasan Kerja Karyawan Penelitian ini bertujuan untuk menganalisis pengaruh beban kerja, dan kompensasi terhadap kepuasan kerja karyawan. Populasi dalam penelitian ini adalah 24 karyawan PT. Tri Poda Parama. Metode penarikan sampel adalah teknik sampling jenuh. Metode pengumpulan data menggunakan metode survey, dengan instrument penelitian adalah kuesioner. Metode analisis data menggunakan Partial Least Square. Penelitian ini membuktikan bahwa beban kerja berpengaruh negatif dan signifikan terhadap kepuasan kerja karyawan. Kompensasi berpengaruh positif dan signifikan terhadap kepuasan kerja karyawan. Universitas Mercu Buana 2019-12-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7177 10.22441/jimb.v5i3.7177 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 3 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 152-165 2655-7274 2460-8424 10.22441/jimb.v5i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7177/2983 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/13535 2022-10-07T09:28:10Z jimb:ART driver

The Influence Of Financial Literacy And Financial Behavior On Investment Decision Nugraha, Rifqi Kurnia Eksanti, Arlina Putri Haloho, Yustus Odema Financial Literacy, Financial Behavior, Investment Decision This research is a quantitative research which aims to determine the effect of financial literacy and financial behavior on investment decisions. The population in this study were active students at Mercu Buana University, Jakarta. The sample is 43 respondents. Non-probability sampling method, purposive sampling. Data collection is done by distributing questionnaires to a predetermined sample via google form. The data analysis technique used the PLS (Partial Least Square) analysis method with SmartPLS 3.0 software. The results of this study indicate that: (1) Financial literacy has an influence on investment decisions with a path coefficient value of 0.338 (2) Financial behavior has an influence on investment decisions with a path coefficient value of 0.509. Universitas Mercu Buana 2022-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13535 10.22441/jimb.v8i1.13535 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 1 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 68-78 2655-7274 2460-8424 10.22441/jimb.v8i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13535/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/15185 2023-11-30T15:11:24Z jimb:ART driver

The Influence of Brand Image and Product Price towards Purchase Decision at E-commerce Tokopedia Prasetio, Adhi Angelina, Adevia Puji Brand Image; Product Price; Purchase Decision; E-commerce; Tokopedia Internet growth in Indonesia has rapidly affected economic stability. Buying and selling transaction becoming more efficient and could be done without face to face through online platform such as e-commerce as the effect of internet development. Tokopedia is one of the successful e-commerce which was ranked in the first position of the highest transaction in Indonesia, therefore this research for a benchmark is needed. The purpose of this study was to determine partially the influence of brand image and product price towards purchase decision and the influence of simultaneous brand image and product price towards purchase decision. This research was conducted on e-commerce Tokopedia users with sample around 400 taken using purposive sampling. Data was collected using online questionnaire with multiple linear regression technique analysis. Data was proceed using SPSS 25 for Mac. The result show brand image and product price have a partially significant effect towards on Tokopedia e-commerce purchase decision. Also brand image and product price have a simultaneous significant effect towards on Tokopedia e-commerce purchase decision. Universitas Mercu Buana 2023-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15185 10.22441/jimb.v9i1.15185 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 1 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 67-83 2655-7274 2460-8424 10.22441/jimb.v9i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15185/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/37813 2026-04-04T08:45:13Z jimb:ART driver

THE INFLUENCE OF SERVICE QUALITY, DIGITAL CUSTOMER EXPERIENCE AND BRAND IMAGE ON CUSTOMER SATISFACTION OF THE I.SAKU APPLICATION IN BANDUNG CITY Suparwo, Adi Nur Halizha, Shafna Fatimah Mauliyan, Feti Brand Image, Customer Satisfaction, Digital Customer Experience, Service Quality ABSTRACTWith the advancement of technology, it is easier for people to make cash transactions without cards using e-wallets. The rise of e-wallets today makes users consider more about the quality of service, ease of usage, brand image from e-wallet when they want to use it.  This research seeks to examine the effect of service quality, digital customer experience and brand image to customer satisfaction for the I.Saku Application in Bandung City. Descriptive and verification research methodologies are used in this study’s through a quantitative method. The object is studied in this study were customers of the I.Saku Application in Bandung City using a total 100-person sample. The sampling method regulated in this case research is the nonprobability sampling method with purposive sampling technique. Statistics data this study uses multiple linear regression data analysis with the help of statistical processing of data tools bye using IBS SPSS statistic 25 application. The findings of this study illustrate that partially the service quality variable has a significant effect on customer satisfaction of the I.Saku Application in Bandung City and brand image has a significant effect on customer satisfaction of the I.Saku Application in Bandung City. Meanwhile, digital customer experience does not have a significant effect on customer satisfaction of the I.Saku Application in Bandung City. Simultaneously, service quality, digital customer experience and brand image have a joint effect on customer satisfaction of the I.Saku Application in Bandung City. Universitas Mercu Buana 2026-04-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/37813 10.22441/jimb.v12i1.37813 Jurnal Ilmiah Manajemen dan Bisnis; Vol 12, No 1 (2026): Jurnal Ilmiah Manajemen dan Bisnis; 106-120 2655-7274 2460-8424 10.22441/jimb.v12i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/37813/pdf Copyright (c) 2026 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/4401 2018-11-19T07:08:18Z jimb:ART driver

STUDI PENERAPAN MODEL OPERATION REFERENCES (SCORE) PADA PERUSAHAAN PEMASOK TURBINE DI INDONESIA (STUDI KASUS PT. XYZ) Marlapa, Eri Sutawidjaya, Achmad H. Supply Chain Operation Reference (SCOR); Supply Chain Management; Aktivitas supply chain manajemen bagi perusahaan merupakan bagian yang tidak dapatdipisahkan dalam kegiatan rantai pasok. Perusahaan yang dapat mempertahankan kinerjarantai pasoknya dengan baik maka perusahaaan tersebut dapat bertahan dalam era persaingan.PT.XYZ adalah perusahaan yang bergerak dalam pengiriman turbin. Saat ini perusahaanmempunyai persoalan dalam pengiriman turbine parts ke pelanggan sering terjadi keterlambatan, sehingga perlu adanya pengukuran performansi yang sifatnya menyeluruh atau komprenhensif untuk meningkatkan pelayana bagi konsumen. Tujuan penelitian ini untuk mengevaluasi kinerja perusahaan berdasarkan penerapan model Supply Chain Operation Reference (SCOR).Metode penelitian yang digunakan adalah pendekatan quantitative denganstudi kasus di perusahaan PT.XYZ, Jakarta. Data diperoleh dengan melalui studi lapangan kepada pelanggan Pertamina Hulu Energi (PHE) periode tahun 2012 sampai 2015. Hasil penelitian menunjukkan dengan menggunan metode Supply Chain Operation Reference (SCOR)bahwa kondisi rantai pasok di PT.XYZ kurang efisien karena metrik pengukuran yang dimiliki nilai POF dan OCFT berada di bawah nilai median industri yaitu nilai Advantage Data Benchmark. Universitas Mercu Buana 2018-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4401 10.22441/jimb.v4i1.4401 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 1 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 86-100 2655-7274 2460-8424 10.22441/jimb.v4i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4401/2168 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/568 2018-08-25T04:29:54Z jimb:ART driver

PERBANDINGAN RASIO KEUANGAN PERBANKAN INDONESIA BERDASARKAN KELOMPOK BANK MENURUT BANK INDONESIA (BI) PERIODE TAHUN 2007 - 2013 Viciwati, Viciwati Pulungan, Nur Aisyah F After more than 10 years of economic crisis that makes the banking world collapsed then gradually slow start banking world might be improved. Various rules and regulations of Bank Indonesia adapted to the current state of the crisis with the intention that public funds are protected and the business climate in Indonesia can be run safely. The results of research that aims to look at the performance of banks for the period 2007 to 2013 show the performance of banks in Indonesia has improved this can be seen from the financial ratios include ROA, CAR, LDR, NPL and ROA which is in accordance with the ratio that is standardized by BI to each ratio were investigated. And for a group of banks surveyed the BPD group, and the mixture Bank Foreign Bank has assessed the performance is quite prominent due to the precautionary principle is applied properly it is also supported with sufficient capital and technology as well as a good human resoures. Keywords: Ratio of Banking, the bank group Universitas Mercu Buana 2016-05-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/568 10.22441/jimb.v1i1.568 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 1 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 134-152 2655-7274 2460-8424 10.22441/jimb.v1i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/568/499 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/31041 2024-12-11T06:07:33Z jimb:ART driver

Understanding the Appeal of Local Cosmetics of Mustika Ratu Cosmetics in Shaping Indonesian Generation Z Purchase Intentions Annisa, Nur Hanafiah, Ali Brand Image; Product Quality; Price Perception; Purchase Intention; Indonesian Generation Z Indonesia is a promising market for cosmetics and personal care products, providing opportunities for domestic and international manufacturers. The Indonesian cosmetics market is estimated to have reached around US$8.8 billion in 2021 and is expected to continue growing. One of the prominent local cosmetic companies is PT Mustika Ratu Tbk, which is renowned for its natural-based beauty products that combine traditional Indonesian ingredients with modern technology. However, Mustika Ratu faces challenges in maintaining its market position, particularly among Generation Z consumers, who represent a significant and growing demographic in Indonesia. This study aims to examine the factors influencing the purchase intention of Mustika Ratu's products among Indonesian GenZ, focusing on brand image, product quality, and price perception. Using a quantitative approach, data were collected through structured questionnaires from 168 respondents in the Jabodetabek area and analyzed using Partial Least Square (PLS) software version 3.2.9. The results of this study indicate that Brand Image, Product Quality, and Price Perception has a positive and significant influence on purchase intention of Mustika Ratu cosmetic products in Indonesian Generation Z. Universitas Mercu Buana 2024-12-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/31041 10.22441/jimb.v10i3.31041 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 3 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 406-418 2655-7274 2460-8424 10.22441/jimb.v10i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/31041/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/15675 2022-12-15T10:40:39Z jimb:ART driver

Analysis Location, Word Of Mouth and Security Against the Decision to Purchase Permata Buana Kembangan Housing in West Jakarta Samudro, Amzad Hamdan, Hamdan Rahmat, Abdul Location, Word Of Mouth (WOM), Security, purchasing decisions This research is about the decision to buy housing at Permata Buana Kembangan, West Jakarta and this study aims to determine the effect of location, word of mouth, and security on purchasing decisions for Permata Buana housing and respondents who will buy Permata Buana housing. This research is descriptive and quantitative. Primary data and secondary data were obtained. Secondary data was obtained from various sources such as journalists, books, and primary data for other related publications obtained by distributing questionnaires to target respondents. Determination of the number of samples using the purposive sampling technique will be distributed via google form to 83 respondents obtained. The results showed that Location had a significant relationship with purchasing decisions, Word of Mouth was not significant for purchasing decisions, and Security was not significant for purchasing decisions. Universitas Mercu Buana Universitas Mercu Buana Fakultas Ekonomi dan Bisnis 2022-12-15 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15675 10.22441/jimb.v8i3.15675 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 3 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 377-390 2655-7274 2460-8424 10.22441/jimb.v8i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15675/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/16134 2023-12-07T03:09:20Z jimb:ART driver

E-Commerce, Self Assessment System, Tax Knowledge and Automatic Exchange of Information on Tax Avoidance Intentions Rista, Novi Aprilina, Vita Baryanto, Sugeng E-Commerce, Self Assessment System, Tax Knowledge, AEoI, Tax Avoidance. This study aims to examine whether or not there is an effect of E-Commerce, Self Assessment System, Tax Knowledge and Automatic Exchange of Information (AEoI) on the Tax Avoidance Intentions of E-commerce Business Actors. The research method uses a quantitative approach. The data used are primary data by distributing questionnaires in the form of Google forms to e-commerce business people. The research population is e-commerce players in West Java Province as many as 1,820 e-commerce business people. Determination of the sample with the Slovin formula resulted in 100 respondents. The sampling technique is purposive sampling with data analysis using Multiple Linear Regression. The results of this study indicate that Tax Knowledge has a positive effect on intention to avoid tax while E-Commerce, Self Assessment System and Automatic Exchange of Information (AEoI) have no effect on intention to avoid tax. Universitas Mercu Buana Vita Aprilina, Sugeng Baryanto 2023-12-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/16134 10.22441/jimb.v9i3.16134 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 3 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 393-405 2655-7274 2460-8424 10.22441/jimb.v9i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/16134/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/16134/3288 Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5630 2019-12-12T10:28:12Z jimb:ART driver

ANALISIS PERHITUNGAN NILAI OVERALL EQUIPMENT EFFECTIVENESS (OEE) SEBAGAI DASAR UNTUK PERBAIKAN DI MESIN HIGH PRESSURE DIE CASTING MENGGUNAKAN PENDEKATAN LEAN MANUFACTURING (STUDI KASUS PADA PT ASTRA OTOPARTS TBK DIVISI NUSAMETAL) Winarto, Winarto Ediyanto, Ediyanto nilai overall equipment effectiveness, six big losses, high pressure die casting, perusahaan kelas dunia, lean manufacturing Penelitian ini dilatarbelakangi adanya biaya lembur sebesar Rp 4,28 milyar di mesin HPDC selama periode Januari – Oktober 2014 di mana menurut perhitungan PPIC kapasitas produksi mencukupi tanpa adanya lembur. Penelitian ini bertujuan mengevaluasi kinerja mesin High Pressure Die Casting (HPDC) di PT Astra Otoparts Tbk Divisi Nusametal apakah sudah mencapai perusahaan kelas dunia sesuai visi perusahaan. Penelitian ini menggunakan pendekatan deskriptif. Teknik analisis secara kuantitatif menggunakan metode analisis nilai Overall Equipment Effectiveness (OEE). Dari hasil perhitungan nilai OEE akan dibandingkan dengan standar nilai OEE untuk perusahaan level dunia. Di samping itu juga dianalisis secara kualitatif menggunakan identifikasi six big losses penyebab terjadinya downtime di proses HPDC. Data penelitian merupakan data Laporan Harian Produksi untuk periode Januari sampai dengan Desember 2014. Dari hasil perhitungan data diperoleh kesimpulan bahwa rata-rata nilai OEE di mesin HPDC adalah 61,60% yang berarti PT Astra Otoparts Tbk Divisi Nusametal belum masuk perusahaan level dunia. Berdasarkan identifikasi six big losses, breakdown mesin menyumbang downtime sebesar 51%, diikuti setup and adjustment sebesar 26%, production rejects sebesar 17%, dan small stops sebesar 6%. Berdasarkan kategori OEE, downtime loss berkontribusi terbesar atas terjadinya downtime mesin yaitu sebesar 77%, diikuti quality loss sebesar 17%, dan speed loss sebesar 6%. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5630 10.22441/jimb.v5i1.5630 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 1 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 126 - 138 2655-7274 2460-8424 10.22441/jimb.v5i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5630/2569 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/13292 2021-11-30T15:43:04Z jimb:ART driver

The Effect Of Individual Characteristics, Organizational Commitments And Leadership Profiles On Employee Performance In The Implementation Work From Home (WFH) (Study On Student Employees At Mercu Buana University) Kurniawan, Deden Sarwono, Indra Individual Characteristics, Organizational Commitment, Leadership Profile, Employee Performance. This study analyzed the effect of individual characteristics, organizational commitment and leadership profile on employee performance in implementing Work From Home (WFH). The object of this research was student employees of Mercu Buana. This research is qualitative research with a questionnaire instrument as the survey method. The approach used in this research is Structural Equation Model (SEM) with the Smart-PLS analysis tool. A total of 286 respondents participated in this research. The sample size was determined by the sloven formula and generated a sample of 167 employees. This study proves that individual characteristics positively and significantly affect employee performance with a T-statistic value of (3,845). Organizational commitment has a positive and significant effect on employee performance with a T-statistic value (3.136). The leadership profile positively and significantly affect employee performance with a T- statistic value of(4.095). Universitas Mercu Buana 2021-11-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13292 10.22441/jimb.v7i3.13292 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 3 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 286-293 2655-7274 2460-8424 10.22441/jimb.v7i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13292/4942 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/36320 2025-12-04T03:24:26Z jimb:ART driver

Empirical Evidence on the Mediating Role of Attitude Between Environmental Concern and Perceived Usefulness toward Electric Motorcycles Adoption Intentions Among Female Gen Z Narayani, Ni Komang Prema Hanafiah, Ali Environmental Concern; Perceived Usefulness; Stimulus-Organism-Response Theory; Electric motorcycles; Generation Z The global reliance on fossil fuels has intensified the energy crisis and worsened urban air pollution, creating an urgent need for sustainable transportation solutions. Electric motorcycles offer a promising alternative, especially in Indonesia where motorcycle use is widespread. This study investigates the influence of environmental concern and perceived usefulness on the intention of female Gen Z consumers to adopt SELIS electric motorcycles, with attitude toward electric motorcycles as a mediating variable. Data were collected through a structured online questionnaire using purposive sampling and analyzed with Partial Least Squares Structural Equation Modeling (PLS-SEM) in SmartPLS. The findings reveal that both environmental concern and perceived usefulness significantly enhance intention to use, while also shaping favorable attitudes toward electric motorcycles. Attitude itself exerts a strong positive influence on intention and mediates the relationships between the independent variables and intention. These results highlight that adoption decisions are driven not only by ecological awareness but also by functional value, with attitude reinforcing this effect. The study concludes that strategies integrating sustainability messages with practical benefits are essential to encourage wider adoption of electric motorcycles among female Gen Z consumers. Universitas Mercu Buana 2025-12-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/36320 10.22441/jimb.v11i3.36320 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 3 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 353-368 2655-7274 2460-8424 10.22441/jimb.v11i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/36320/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3847 2018-09-10T02:38:32Z jimb:ART driver

PENGARUH KOMUNIKASI DAN PENGEMBANGAN KARIER TERHADAP KINERJA KARYAWAN (Studi Kasus pada Kayawan PT Ideal Fastener Indonesia) Nuryadi, Hasan Widayati, Catur Fakultas Ekonomi Universitas Tarumanagara, Tupiyati Rahardjo, Mukti komunikasi; pengembangan karier; kinerja karyawan; Penelitian ini untuk mengetahui pengaruh komunikasi dan pengembnagan karier terhadapkinerja karyawan. Objek penelitian ini adalah karyawan diperusahaan PT Ideal FastenerIndonesia dengan usaha bergerak dibidang manufaktur yang berlokasi di Tangerang.Penelitian ini dilakukan terhadap 70 responden.Teknik sampling yang digunakan dalampenelitian ini adalah sampel jenuh. Karena itu, analisis data yang digunakan adalahanalisis statistik dalam bentuk uji regresi linear berganda.Hasil penelitian ini menunjukanbahwa secara parsial, variabel komunikasi mempunyai pengaruh positif terhadap variabelkinerja karyawan. Variabel penegembangan karier mempunyai pengaruh positif terhadapvariabel kinerja karyawan. Hal ini dibuktikan dari hasil uji hipotesis (ujit) menunjukannilai signifikasi dari variabel bebas. Universitas Mercu Buana 2018-09-10 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3847 10.22441/jimb.v3i2.3847 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 2 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 170-188 2655-7274 2460-8424 10.22441/jimb.v3i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3847/2015 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/5936 2019-07-05T15:33:14Z jimb:ART driver

PENGARUH PENGETAHUAN PEMILIK, MANFAAT YANG DIRASAKAN, DUKUNGAN PEMERINTAH, DAN DORONGAN EKSTERNAL TERHADAP PENGADOPSIAN E-COMMERCEBERBASIS MEDIA SOSIAL Mahliza, Febrina adoption of e-commerce, social media. Many of MSME’s especially micro enterprises are still not utilizing social media as a media of product promotion. This study aims to determine the adoption of e-commerce based on social media on micro business, which is about the factors that affect the adoption. The research was conducted on 100 respondents of micro business actors in Jabodetabek taken by purposive sampling method. Data were analyzed using structural equation modeling with Partial Least Square (PLS) approach. The results show that the adoption of social media-based e-commerce conducted by micro enterprises is influenced by knowledge of the owner, perceived benefits and external drives. The government support factor has no significant effect on the adoption of e-commerce because there is no government support in a concrete policy for micro enterprises. Universitas Mercu Buana 2018-11-14 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5936 10.22441/jimb.v4i2.5936 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 2 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 171-184 2655-7274 2460-8424 10.22441/jimb.v4i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5936/2612 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/8903 2020-12-15T10:40:37Z jimb:ART driver

Keputusan Bertahan: Inisiatif Sosial Berkelanjutan Usaha Mikro Perhiasan Imitasi Di Desa Sunan Giri, Gresik-Jawa Timur Khasanah, Uswatun Kristina, Anita Lingkungan Bisnis, Keputusan Bertahan, Inisiatif Sosial, Keberlanjutan Usaha, Usaha Mikro This study aims to analyze and discuss the survival decisions of imitation jewelry micro business owners. Data collection is done through in-depth interviews with business owners and workers. Then the data are processed and analyzed inductively. The results found that the existence of imitation jewelry business began to change in line with changes in the business environment due to business competition. Another finding is that the business owner decides to stay on his business carried out as a social initiative, namely the owner provides social benefits for the environment and surrounding communities through the creation of jobs based on moral obligations and reinforces the value of togetherness and kinship. The orientation of the decision to survive is not only on economic benefits but on social benefits, through governance based on ethics and existing values. The results of this study can also provide recommendations for further research opportunities, for example the development of research with other issues, namely knowing the transaction costs at each social initiative undertaken by business owners. Universitas Mercu Buana 2020-12-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8903 10.22441/jimb.v6i3.8903 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 3 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 324 - 334 2655-7274 2460-8424 10.22441/jimb.v6i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8903/3996 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/1748 2017-09-28T00:46:20Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3712 2018-09-03T07:02:12Z jimb:ART driver

PENGARUH KEGIATAN REVERSE LOGISTICS TERHADAP KINERJA SUPPLIER CHAIN POSITION INDUSTRI TELEPON SELULAR Maheswari, Hesti Santoso, Agung Sigit Kuncoro, Devi Putri Reverse logistics; suppliers; e-waste; Sampah eletronik (ewaste) adalah limbah yang berasal dari peralatan elektronik yang telah rusak, bekasdan tidak dipakai lagi.Sampah elektronik adalah limbahyang pertumbuhannya paling tinggi tiap tahunnya.Sampahini mengandung material dan logam yang berharga disamping itu mengandung bahan berbahayadan beracun (B3) yang dapat merusak lingkungan jika sampah ini tidak dikelola dengan baik. Karenasifatnya tersebut, banyak kasus ekspor sampah elektronik dari Negara maju ke Negara berkembang atauNegara miskin.Reverse logistics merupakan kegiatan pemanfaatan nilai dari produk yang sudah tidakterpakai. Implementasi yang tepatdarisistem reverse logistics(RL)dapat menghasilkanpengurangan biayaoperasional karena menggunakan kembali atau rekondisidaribeberapabagian selain mengerukkeuntungan.Halinisangatpentingbagiindustriindustri dengan produkproduk yangbersiklus hidupprodukpendek,sepertiindustriteleponseluler.Sampel penelitian ini adalah supplier chain perusahaan telepon selular.Dari hasil penelitian dapatdisimpulkan bahwa para wholesaler dan service centre tidak tertarik dengan kegiatan reverse logistics,sedangkan retailer tertarik melakukan kegiatan tersebut namun kegiatan ini justru memberikan dampaknegative terhadap kinerjasupplier chaindi Indonesia.Dampak negatif ini terjadi karena kegiatan reverselogistics menyita energy yang cukup besar namun dari sisi keuntungan tidak maksimal dibandingkan jikamenjualprodukbaru. Universitas Mercu Buana 2016-07-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3712 10.22441/jimb.v2i2.3712 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 2 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 715-737 2655-7274 2460-8424 10.22441/jimb.v2i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3712/1915 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/7660 2020-12-15T10:48:43Z jimb:ART driver

Analisa Factor Yang Mempengaruhi Niat Pembelian Kembali Pada Private Label Hudaya, Agung Keberadaan produk dengan merek private label menjadi prioritas tersendiri bagi para ritailer, karena selain dapat membantu untuk meningkatkan jumlah kunjungan dan penjualan di toko, juga dapat meningkatkan loyalitas pelanggannya.  Perkembangan private label yang sangat pesat dapat terlihat dari semakin banyaknya jenis produk private label yang dipasarkan. Namun perkembangan penjualan produk-produk private label di Toko Alfamidi masih belum memuaskan dan cenderung stagnan perkembangannya secara nasional. Kondisi masih rendahnya tingkat konsumsi produk private label Alfamidi, padahal perusahaan telah melakukan pendekatan dengan berbagai aktivitas promosi. Berkaitan dengan hal tersebut tujuan dari penelitian ini adalah untuk mendapatkan model niat pembelian kembali dan mengetahui pengaruh kesadaran merek, asosiasi merek, persepsi kualitas, loyalitas merek terhadap niat pembelian kembali produk private label. Penelitian ini dilakukan dengan pendekatan kuantitatif dan teknik pengumpulan datanya survey penyebaran kuisioner pada 100 responden di lokasi penelitian Toko Alfamidi di Kota Tangerang. Hasil penelitian menunjukkan bahwa adanya pengaruh signifikan antara kesadaran merek, asosiasi merek, persepsi kualitas, loyalitas merek terhadap niat pembelian kembali produk private label. Universitas Mercu Buana 2020-04-22 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7660 10.22441/jimb.v6i1.7660 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 1 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 59 - 76 2655-7274 2460-8424 10.22441/jimb.v6i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7660/3355 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/232 2016-05-01T23:16:45Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/13995 2022-08-02T07:18:30Z jimb:ART driver

The Influence Of Competency, Work Environment On Work Involvement And Job Satisfaction Pranitasari, Diah Julian, Julian Competency; Work Environment; Job Involvement; Job Satisfaction This study aims to determine the competence and work environment on job involvement and job satisfaction of employees at PT. Yamaha Music Manufacturing Indonesia.The sample in this study was 100 contract employees, using purposive sampling technique. The analysis used is SEM PLS research to test the Inner model, outer model and hypotheses.The results of the study stated: (1) Competence has an effect on work involvement by 55.2%. (2) The work environment has an effect on work involvement by 39.1%. (3) Competence has an effect on job satisfaction by 36.2%. (4) The work environment has an effect on job satisfaction by 35.2%. Universitas Mercu Buana 2022-08-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13995 10.22441/jimb.v8i2.13995 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 2 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 252-263 2655-7274 2460-8424 10.22441/jimb.v8i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13995/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/13995/2687 Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/21571 2023-12-02T02:57:17Z jimb:ART driver

Determination of Business Strategy with SWOT and AHP Prasetya, Prita AHP, Business Strategy, Paint industry, SWOT This study aims to formulate strategic decision-making in the paint industry through the SWOT-AHP hybrid method. The calculated priorities of the SWOT factor can form a management approach to the company's main decisions. The calculated priorities of the SWOT factor can form a management approach to the company's main decisions. From the study results, it is expected to get an overview of the application of strategic analysis using the hybrid SWOT-AHP method based on influencing factors. AHP analysis using expert choice software. The SWOT analysis and AHP method results produce strategy priorities: (1) Build omni channel, (2) Build close relationships with all channels. (3) Build a close relationship with personal values, especially for Pareto stores. (4) Sales collaboration, (5) Start building infrastructure for digital business, (6) Formulate strategies to build collaborative relationships. Universitas Mercu Buana 2023-08-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/21571 10.22441/jimb.v9i2.21571 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 2 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 263-280 2655-7274 2460-8424 10.22441/jimb.v9i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/21571/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5618 2019-05-07T05:59:51Z jimb:ART driver

PENGARUH PROFITABILITAS, LIKUIDITAS, LEVERAGE, KEBIJAKAN DIVIDEN, DAN UKURAN PERUSAHAAN TERHADAP NILAI PERUSAHAAN (Studi Empiris Perusahaan Sektor Real Estate, Properti, dan Konstruksi Bangunan yang Terdaftar di Bursa Efek Indonesia Tahun 2014-2016) Oktaviarni, Fakhrana Murni, Yetty Suprayitno, Bambang Nilai Perusahaan; Profitabilitas; Likuiditas; Leverage; Kebijakan Dividen; Ukuran Perusahaan Penelitian ini bertujuan untuk mengetahui secara empiris pengaruh profitabilitas, likuiditas, leverage, kebijakan dividen, dan ukuran perusahaan terhadap nilai perusahaan. Populasi dalam penelitian ini adalah perusahaan sektor real estate, properti, dan konstruksi bangunan yang terdaftar di Bursa Efek Indonesia tahun 2014-2016. Pengambilan sampel ditentukan dengan menggunakan metode purposive sampling sehingga didapat 22 perusahaan. Jenis data yang digunakan adalah data sekunder yang diperoleh dari www.idx.co.id. Metode analisis yang digunakan adalah analisis regresi berganda. Hasil yang ditunjukkan pada penelitian ini menunjukkan bahwa rasio profitabilitas yang diproksikan dengan Return on Assets (ROA), likuiditas yang diproksikan dengan Current Ratio (CR), kebijakan dividen yang diproksikan dengan Dividend Payout Ratio (DPR), dan ukuran perusahaan yang diproksikan dengan logaritma natural total aset berpengaruh terhadap nilai perusahaan, sedangankan leverage yang diproksikan dengan Debt to Equity Ratio (DER) tidak berpengaruh terhadap nilai perusahaan. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5618 10.22441/jimb.v4i3.5618 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 3 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 414 - 428 2655-7274 2460-8424 10.22441/jimb.v4i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5618/2558 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/12279 2021-07-30T16:25:49Z jimb:ART driver

SOCIO CULTURAL PARADIGM OF BRAND TRUST RELATIONSHIP TO PURCHASE INTENTION NU GREEN TEA IN THE VILLAGE OF MENGANTI, GRESIK Poernomo, Tri Tjahjo Keywords: brand trust; judgement sample; purchase intention Abstract This research article aims to identify the positivity of the brand trust relationship (viability dimension & intentionality dimension) to purchase intention. The research sampling consisted of 60 participants who consumed green tea drinks in the village of Menganti, through a judgement sample approach (Cooper & Emory, 2013). There is a positive relationship between brand trust and purchase intention green tea drink of the product, in line with research support that has been carried out by (Fang, Chiu & Wang, 2011). Revealed that there is a positive relationship between brand trust and repurchase intention. H1 & H2 observations can be accepted in the factuality as empiric.   Universitas Mercu Buana wijaya kusuma surabaya of university 2021-07-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12279 10.22441/jimb.v7i2.12279 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 2 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 243-252 2655-7274 2460-8424 10.22441/jimb.v7i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12279/4653 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/32424 2025-08-20T14:28:46Z jimb:ART driver

The Effect of Work Climate Work Environment and Work Motivation on the Morale of Contract Employees at the Environmental Service of Gianyar Regency Wirawan, I Kadek Arya Yudi Adiandari, Ade Maharini Geriadi, Made Ayu Desy work climate; work environment; work motivation; work morale The aim of this research is: To determine the influence of work climate, work environment and work motivation simultaneously and partially on work morale at the Gianyar Regency Environmental Service. Sampling was carried out using the census method or saturated sample, namely 48 contract employees. The data sources used are primary data and secondary data, the nature of the data is quantitative data and qualitative data. Data collection techniques include observation, interviews, questionnaires and documentation studies. The research results show that work climate, work environment and work motivation have a positive and significant effect simultaneously and partially on the work morale of contract employees at the Gianyar Regency Environmental Service. Universitas Mercu Buana 2025-08-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32424 10.22441/jimb.v11i2.32424 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 2 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 231-244 2655-7274 2460-8424 10.22441/jimb.v11i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32424/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3830 2018-09-08T01:04:37Z jimb:ART driver

EVALUASI PELATIHAN PADA DIKLAT TEKNIS SUBSTANTIF SPESIALISASI (DTSS) ANALISIS INFORMASI, DATA, LAPORAN, DAN PENGADUAN (IDLP) DASAR Santoso, Agung Sigit Rahman, Erry Rizal Evaluasi; Pelatihan; Evaluasi Pelatihan; Diklat Teknis Substantif Spesialisasi (DTSS) Analisis Informasi; Data; Laporan; Pengaduan (IDLP) Dasar; Penelitian ini bertujuan untuk mengevaluasi pelatihan Diklat Teknis Substantif Spesialisasi (DTSS) Analisis Informasi, Data, Laporan, dan Pengaduan (IDLP) Dasar yang dilakukan oleh Pusdiklat Pajak RI.Penelitian dilakukan terhadap pegawai yang telah mengikuti pelatihan ini di tanggal 6 sampai dengan 10 April2015 dengan jumlah peserta sebanyak 30 orang peserta. Pengumpulan data dilakukan dengan menggunakanteknik dokumentasi yaitu dengan mengumpulkan informasi mengenai evaluasi pelatihan yang dilakukanPusdiklat Pajak pada pelatihan ini. Desain yang digunakan penelitian ini adalah metode deskriptif kualitatif dan kuantitatif. Metode pengolahan data menggunakan teori evaluasi pelatihan Kirkpatrick yang hanyasampai 3 level. Hasil penelitian, diperoleh gambaran evaluasi pelatihan pada ketiga level menunjukkan hasil yangbaik. Untuk hasil evaluasi pada level 1 yaitu tingkat kepuasan menunjukan tingkat kepuasan yang sangattinggi dengan rata-rata nilai 4,47 dengan hasil uji hipotesis Ha1 diterima dan Ho1 ditolak. Untuk hasil evaluasipada level 2 yaitu tingkat kelulusan yang menujukkan tingkat kelulusan diatas 50% dengan presentasesebesar 90% dengan hasil uji hipotesis Ha2 diterima dan Ho2 ditolak. Untuk hasil evaluasi pada level 3 yaitumenujukkan adanya perubahan perilaku dari peserta pasca pelatihan dengan hasil kuisioner yang disebarkanalumni, rekan alumni, dan atasan alumni menyetujui adanya perubahan perilaku pada almuni pascapelatihan dengan hasil uji hipotesis Ha3 diterima dan Ho3 ditolak. Hasil uji hipotesis pada ketiga hipotesisialah Ha diterima dan Ho ditolak. Universitas Mercu Buana 2016-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3830 10.22441/jimb.v2i3.3830 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 3 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 789-798 2655-7274 2460-8424 10.22441/jimb.v2i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3830/2003 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3862 2018-09-10T03:06:28Z jimb:ART driver

PENGARUH TINGKAT EFISIENSI (BOPO) DAN KEMAMPUAN LIKUIDITAS (LDR) DALAM MENILAI KINERJA (ROA) PERBANKAN YANG TERDAFTAR DI BEI Wahyuningsih, Diah Gunawan, Rizky BOPO; Likuiditas (LDR); Profitabilitas (ROA); Penilaian tingkat kesehatan bank sangat penting karena akan mempengaruhi kemampuan bank dan loyalitas nasabah ke bank. Salah satu cara menilai bank kesehatan adalah dengan menggunakan metode analisis unta. Penelitian ini menekankan pada penggunaan rasio terutama rasio bopo, ldr dan roa. Rasio bopo kurang akan meningkatkan profit atau profitabilitas (roa). Rasio ldr yang lebih tinggi sehingga tingkat profitabilitas (roa) akan meningkat. Jika bank roa semakin berkembang, maka keuntungan yang didapat bank akan semakin besar dan posisi bank lebih baik dalam penggunaan aset. Tujuan dari penelitian ini adalah untuk mengetahui bagaimana pengaruh bopo terhadap profitabilitas, bagaimana pengaruh likuiditas terhadap profitabilitas, dan seberapa besar pengaruh bopo dan likuiditas terhadap profitabilitas perusahaan perbankan yang terdaftar di tahun 2010-2014.Metode yang digunakan adalah penelitian deskriptif kuantitatif. Analisis teknikal yangdigunakan adalah analisis regresi linear berhala. Sampel ditentukan berdasarkan metodepurposive sampling, sehingga diperoleh sampel dari 14 perusahaan. Pengolahan datadengan menggunakan ibm spss 22. Berdasarkan penelitian yang dilakukan uji parsial (Ujit) dan simultan (uji F) adalah bopo menghasilkan jumlah sig sebesar 0,000 yang lebihkecil dari 0,05, yang berarti bopo memiliki pengaruh negatif. dan secara signifikanterhadap profitabilitas (return on assets), likuiditas (loan deposit ratio) menghasilkan sigsebesar 0,149 apa yang lebih besar dari 0,05, yang berarti likuiditas (loan deposit ratio)tidak signifikan terhadap profitabilitas (return on assets) dan anova tabel menghasilkan sigdari. Dengan demikian bopo dan likuiditas (loan deposit ratio) sekaligus signifikankembali terhadap profitabilitas aset. Prediksi kemampuan kedua variabel independenterhadap roa adalah 72%, sisanya 28% dijelaskan oleh variabel penelitian model lainnya. Universitas Mercu Buana 2017-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3862 10.22441/jimb.v3i3.3862 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 3 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 420-431 2655-7274 2460-8424 10.22441/jimb.v3i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3862/2030 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/8890 2020-12-15T10:49:05Z jimb:ART driver

PENGARUH BUDAYA ORGANISASI, GAYA KEPEMIMPINAN DAN JOB INSECURITY TERHADAP KINERJA KARYAWAN (STUDI KASUS PADA NON GOVERNMENT ORGANIZATION YAPARI) Aritonang, Maylinhart Herminingsih, Anik Budaya Organisasi, Gaya Kepemimpinan, Ketidakamanan Kerja, Kinerja Karyawan YAPARI Tujuan penelitian ini adalah untuk mengetahui pengaruh budaya organisasi, gaya kepemimpinan dan job insecurity terhadap kinerja karyawan pada Non Government Organization YAPARI. Jenis penelitian kuantitatif, populasi seluruh karyawan YAPARI, teknik pengambilan sampel Non Probability Sampling dengan sampel jenuh. Data diolah menggunakan regresi linear berganda dengan SPSS versi 22. Hasil penelitian menunjukkan bahwa gaya kepemimpinan tidak berpengaruh signifikan terhadap kinerja karyawan. Secara parsial budaya organisasi dan job insecurity berpengaruh positif terhadap kinerja karyawan. Hasil matrik korelasi antar dimensi bisa diketahui bahwa variabel budaya organisasi yang paling kuat hubungannya adalah orientasi orang terhadap kuantitas, disarankan kepada manajemen YAPARI lebih memperhatikan karyawan untuk diberikan reward atas pekerjaan maksimal yang telah dilakukan, dan dapat dipastikan tanpa orientasi karyawan itu sendiri mereka tidak akan kerja secara optimal. Kemudian hasil matrik korelasi antar dimensi variabel job insecurity yang paling kuat hubungannya adalah tingkat ancaman dari aspek pekerjaan terhadap kuantitas. Maka disarankan kepada manajemen YAPARI bisa memanfaatkan kondisi ini dengan membuat sosialisasi kepada karyawan untuk membuat suatu perubahan untuk YAPARI antara lain bersama-sama mencari funder baru dengan membangun raising team. Universitas Mercu Buana 2020-07-27 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8890 10.22441/jimb.v6i2.8890 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 2 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 184 - 200 2655-7274 2460-8424 10.22441/jimb.v6i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8890/3597 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3539 2018-09-03T04:11:29Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3627 2018-08-29T09:50:23Z jimb:ART driver

PENGARUH PERTUMBUHAN ASET, PERTUMBUHAN PENJUALAN, PROFITABILITAS, LIKUIDITAS DAN UKURAN PERUSAHAAN TERHADAP PENGARUH PERTUMBUHAN ASET, PERTUMBUHAN PENJUALAN, PROFITABILITAS, LIKUIDITAS DAN UKURAN PERUSAHAAN TERHADAP DEBT TO TOTAL ASSET PADA PERUSAHAAN PEMBIAYAAN YANG TERDAFTAR DI BEI TAHUN 2010 – 2013 DEBT TO TOTAL ASSET PADA PERUSAHAAN PEMBIAYAAN YANG TERDAFTAR DI BEI TAHUN 2010 – 2013 Wahyono, Tri Debt To Total Asset; Asset Growth; Sales Growth; Profitability; Firm Size; The main purpose of this research was to determine whether the variable asset growth, sales growth,profitability, and firm size are considered to affect the debt to total asset by a variety of literature andprevious research. The sampling method use purposive sampling. Tecnique of data analysis use multiplelinear regression analysis by pooling the data. The results showed that five independent variablessimultaneously significant effect on debt to total asset with F score 19,132 and probability score 0,000, less than significantcy score 0,05. The asset growth and sales growth does not influence has a positive andsignificant influence on debt to total asset, while profitability has a negative influence on debt to total asset.Meanwhile, two other variables, liquidity and business risk has a positive and significant influence debt tototal asset.The main purpose of this research was to determine whether the variable asset growth, sales growth,profitability, and firm size are considered to affect the debt to total asset by a variety of literature andprevious research. The sampling method use purposive sampling. Tecnique of data analysis use multiplelinear regression analysis by pooling the data. The results showed that five independent variablessimultaneously significant effect on debt to total asset with F score 19,132 and probability score 0,000, lessthan significantcy score 0,05. The asset growth and sales growth does not influence has a positive and significant influence on debt to total asset, while profitability has a negative influence on debt to total asset.Meanwhile, two other variables, liquidity and business risk has a positive and significant influence debt tototal asset.  Universitas Mercu Buana 2015-06-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3627 10.22441/jimb.v1i2.3627 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 2 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 177-193 2655-7274 2460-8424 10.22441/jimb.v1i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3627/1889 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3523 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6832 2019-09-05T10:07:57Z jimb:ART driver

PENGARUH CURRENT RATIO, DEBT TO EQUITY RATIO DAN RETURN ON ASSETS TERHADAP PRICE EARNING RATIO (Studi Kasus pada Sub Sektor Konstruksi dan Bangunan yang Terdaftar di Bursa Efek Indonesia Tahun 2012–2017) Firdaus, Iwan Current Ratio, Debt to Equity Ratio, Return On Assets, Price Eraning Ratio Penelitian ini bertujuan untuk mengetahui pengaruh current ratio, debt to equity ratio, dan return on assets terhadap price earning ratio pada perusahaan yang terdaftar di Bursa Efek Indonesia sub sektor konstruksi dan bangunan tahun 2012-2017. Variabel independen dalam penelitian ini adalah cureent ratio, debt to equuity, dan return on assets, sedangkan variabel dependen nya adalah price earning ratio. Pemilihan sampel dalam penelitian ini menggunakan metode sample jenuh dan di dapatkan 6 perusahaan sebagai sample. Data penelitian diperoleh dari Bursa Efek Indonesia. Metode yang digunakan dalam penelitian ini adalah regresi data panel dan didaptkan bahwa model yang lebih tepat digunakan adalah common effect. Hasil penelitian ini menunjukan bahwa current ratio berpengaruh negatif dan tidak signifikan, debt to equity ratio berpengaruh negatif dan tidak signifikan terhadap price earning ratio, dan return on assets berpengaruh negatif dan signifikan terhadap price earning ratio. Universitas Mercu Buana 2019-09-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6832 10.22441/jimb.v5i2.6832 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 2 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 139 - 157 2655-7274 2460-8424 10.22441/jimb.v5i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6832/2872 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/28518 2024-12-05T03:27:29Z jimb:ART driver

The Effect of Board Diversity on Performance Mediated by Company Risk in Consumer Cyclicals Companies Putri, Fara Ghassani Muchtar, Susy board independence; board size; gender diversity; debt to asset ratio; share price; institutional ownership; ROA This research aims to analyze the influence gender on board directors and commissioners on company performance. The data used in this research is secondary data sourced from the annual reports of consumer cyclicals companies listed on the Indonesia Stock Exchange (BEI) during the 2019 - 2023 period. The research sample was selected using a purposive sampling method so that 80 companies were sampled. The data analysis used to test the hypothesis is panel data regression analysis using the Eviews 9 program. The research results show that Gender Diversity has no effect on ROA and Share Prices. Board Independence has no effect on ROA and has a negative effect on share prices. Board Size has a positive effect on ROA and Share Prices. Institutional Ownership has a positive effect on ROA and Share Prices. Liquidity has no effect on ROA and share prices. Gender Diversity has a negative effect on the Debt To Assets Ratio. Board Independence has no effect on the Debt To Assets Ratio. Board Size has no effect on the Debt To Assets Ratio. Institutional Ownership has no effect on the Debt To Assets Ratio. Gender Diversity has a negative effect on ROA and Share Prices which is mediated by the Debt To Assets Ratio. Board Independence has no effect on ROA and Share Prices which are mediated by the Debt To Assets Ratio. Board Size has no effect on ROA and Share Prices which are mediated by the Debt To Assets Ratio. Institutional Ownership has no effect on ROA and Share Prices which are mediated by the Debt To Assets Ratio. Universitas Mercu Buana 2024-12-04 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/28518 10.22441/jimb.v10i3.28518 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 3 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 291-315 2655-7274 2460-8424 10.22441/jimb.v10i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/28518/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/28518/6816 Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5621 2019-12-12T10:28:12Z jimb:ART driver

BAGAIMANAKAH KONFLIK PERAN DAN BEBAN KERJA MEMPENGARUHI KINERJA KARYAWAN DENGAN BURNOUT SEBAGAI VARIABEL INTERVENING Syamsu, Nadya Nandavati Soelton, Mochamad Nanda, Andesna Putra, Ratyuhono Linggarnusantra Pebriani, Putri Konflik Peran, Beban Kerja, Kelelahan, Kinerja Karyawan. Penelitian ini bertujuan untuk menguji dan menganalisis pengaruh konflik peran dan beban kerja terhadap kinerja karyawan dengan burnout sebagai variabel intervening untuk karyawan PT. EDI Indonesia. Metode yang digunakan dalam penelitian ini adalah metode deskriptif. Objek penelitian ini adalah 80 karyawan PT. EDI Indonesia. SEM-PLS adalah alat yang digunakan untuk menganalisis data statistik dalam penelitian ini. Hasil penelitian menunjukkan konflik peran yang memiliki efek positif dan signifikan terhadap kelelahan. Beban kerja yang berpengaruh positif dan signifikan terhadap burnout. Konflik peran yang berpengaruh negatif dan signifikan terhadap kinerja karyawan. Beban kerja yang berpengaruh negatif dan signifikan terhadap kinerja karyawan. Burnout yang berpengaruh negatif dan signifikan terhadap kinerja karyawan. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5621 10.22441/jimb.v5i1.5621 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 1 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 1 - 13 2655-7274 2460-8424 10.22441/jimb.v5i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5621/2560 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3981 2019-07-05T15:08:02Z jimb:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/10803 2021-03-31T18:41:42Z jimb:ART driver

Integrating TAM, VAM, PAM And Security Perception In The Intention Of Fintech Service Usage Hatmawan, Aglis Andhita TAM, VAM, PAM, Security Persptions, Fintech. This study is aims to develop a TAM (Technology Acceptance Model) by integrating a VAM (Value-based Adoption Model), PAM (Pos Acceptance Model) and security perceptions. The frameworks of the theories are expected to deeper explain the perspective perceived by fintech services users in terms of security, perceived value, benefits and satisfaction in using fintech. Survey through a quantitative approach combined with explanatory research in Madiun Residency are used in this research. The results showed that all hypotheses proposed in this study were accepted. Security is the main requirement for people to continue or discontinue using fintech services. Perceived value is a comparative result influenced by the amount of sacrifice made and the perceived benefits. People who are satisfied and tends to assume that the fintech service is valuable, will have a tendency to continue using the fintech service. Therefore, it can be concluded that TAM, VAM, PAM and security perceptions are a unified whole in understanding one's behaviour in adopting technology such as fintech servicces.  Universitas Mercu Buana 2021-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10803 10.22441/jimb.v7i1.10803 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 1 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 101-115 2655-7274 2460-8424 10.22441/jimb.v7i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10803/4362 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3546 2018-08-25T05:35:19Z jimb:ART driver

ANALISA PENGARUH PENGELOLAAN VALUTA ASING TERHADAP POTENSI PENDAPATAN SELISIH KURS Oktaviar, Chairiel Foreign Exchange; Foreign Exchange (FOREX) in any country would be goods or commodities is verytempting because it will bring the benefits of revenue arising from each transaction,however currency also simultaneously contain enough risk frightening when there arefluctuations in the exchange rate very drastic either hike rate or decrease in the exchangerate. Foreign exchange management often does not correspond to the demands and needsof branch operations during takeover for market and the trend does not take into accountfluctuations in the exchange rate would result in losses for the bank. Banks must be goodrhythms urgency of a takeover or a foreign exchange transaction , whether buying orselling bank notes or purchase of traveler checks , since the takeover and resale shouldhave the right timing , the bank is also not allowed to conduct transactions with foreigncurrency exceeding the Net Open Position ( NOP ). Universitas Mercu Buana 2018-08-24 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3546 10.22441/jimb.v3i1.3546 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 1 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 59-70 2655-7274 2460-8424 10.22441/jimb.v3i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3546/1880 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3853 2018-09-10T02:44:01Z jimb:ART driver

PENGARUH PENDIDIKAN, DAN PELATIHAN PRE-JOINING TERHADAP MOTIVASI DAN DAMPAKNYA TERHADAP KINERJA CREW KAPAL DI PT. JASINDO DUTA SEGARA Widianingrum, Ria Nurhayati, Mafizatun pendidikan; pelatihan pre-joining; motivasi; kinerja pelaut (crew); Penelitian ini bertujuan untuk menganalisis pengaruh pendidikan, pelatihan pre-joiningterhadap motivasi dan dampaknya terhadap kinerja crew kapal. Populasi dalam penelitianini adalah pelaut (crew) PT. Jasindo Duta Segara yang berjumlah 706 orang. Sampel yangdipergunakan adalah sebanyak 180 orang. Teknik pengambilan sampel menggunakanconvenience sampling. Metode analisis data menggunakan Structural Equation Model(SEM). Hasil penelitian ditemukan bahwa pendidikan berpengaruh positif terhadapmotivasi. Pelatihan berpengaruh positif terhadap motivasi. Pendidikan tidak berpengaruhterhadap kinerja pelaut (crew). Pelatihan tidak berpengaruh terhadap kinerja pelaut (crew),dan motivasi berpengaruh positif terhadap kinerja pelaut (crew). Universitas Mercu Buana 2017-07-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3853 10.22441/jimb.v3i2.3853 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 2 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 267-283 2655-7274 2460-8424 10.22441/jimb.v3i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3853/2021 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/1764 2018-09-03T03:15:44Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3692 2018-09-03T03:42:47Z jimb:ART driver

DAMPAK ATRIBUT TOKO TERHADAP KEPUTUSAN PEMBELIAN PADA INDOMARET DEPT STORE DI MEDAN Khair, Hazmanan atribut toko; keanekaragaan barang; layout; keputusan pembelian; Atribut toko merupakan satu faktor penting yang mempengaruhi keputusan masyarakat untuk membeliproduk di toko tersebut. Atribut toko ini bisa meliputi performa penempatan produk, bentuk promosi dll.Dalam penelitian ini dibatasi pada lay out toko dan pepelayanan. Tujuan penelitian ini adalah untukmengetahui seberapa besar pengaruh atribut toko terhadap keputusan pembelian konsumen. Sampel yangdiambil adalah 100 pelanggan yang melakukan pembelian di Indomaret Dept. Store yang ada di banyaktempat di kota Medan. Adapun teknik sampling yang digunakan adalah sample kebetulan (accidental). Hasil penelitian menunjukkan bahwa layout toko, pelayanan berpengaruh signifikan terhadapkeputusan pembelian pada Indomaret Dept. Store di Medan. Persamaan regresi ganda Y = 8,851 + 0,319 X1 + 0,382 XPersamaan tersebut memperlihatkan bahwa semua variabel bebas (layout tokodan pelayanan) memiliki koefisien b2 yang positif, berarti seluruh variabel bebas mempunyai pengaruhyang searah terhadap variabel Y (keputusan pembelian). Koefisien korelasi ganda secara bersamasamaantaralayouttokodanpelayanandiperolehRi = 0,566. Nilai yang positif tersebutmempunyai arti bahwa jika layout toko dan pelayanan baik maka keputusan pembelian konsumen akan meningkat. Dari uji F diperoleh 22,893 dengan sig yx1x20,000 <  menunjukan hipotesis 3 (tiga)diterima, berarti layout toko (X1) dan pelayanan (X20,05, ) berpengaruh secara signifikan terhadap Y(keputusan pembelian) pada tarafNilai R-Square yang diperoleh adalah sebesar 0,321menunjukkan sekitar 32,10% variabel layout toko (X0,05. 1) dan pelayanan (X2)mempengaruhi variabel Y(keputusan pembelian). Sisanya dipengaruhi oleh variabel lain yang tidak diteliti . Universitas Mercu Buana 2016-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3692 10.22441/jimb.v2i1.3692 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 1 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 498-515 2655-7274 2460-8424 10.22441/jimb.v2i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3692/1903 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/32374 2025-08-20T14:28:46Z jimb:ART driver

The Influence of Work Conflict, Workload, and Job Stress on the Turnover Intention of Operational Employees at PT. Nippo Mechantronic Indonesia Yrasandhi, Tchiska Adri Sutia, Sabar Adha, Shultonnyck Fahlevi, Mochammad Work Conflict, Workload, Job Stress, Turnover Intention. The purpose of this study is to examine and determine the influence of work conflict, workload, and job stress on turnover intention, as well as to assess whether these factors affect the turnover intention of operational employees at PT. Nippo Mechantronics Indonesia. Data collection was conducted using a quantitative method and involved 54 respondents. Based on the research findings, the F-test results indicate that the calculated F-value (Fhitung) is 12.668, while the table F-value (Ftabel) is 2.790 at α = 0.05. This finding suggests that work conflict, workload, and job stress simultaneously have a positive and significant effect on turnover intention, leading to the acceptance of hypothesis H4. Partially, the t-test results show that the calculated t-value (thitung) for work conflict is 1.939, while the table t-value (ttabel) is 2.005 with a significance level of 0.086. Since thitung (1.939) < ttabel (2.005) and significance (0.086) > 0.05, work conflict does not have a partial effect on turnover intention, resulting in the rejection of hypothesis H1. Similarly, for workload, the calculated t-value (thitung) is 1.635, while the table t-value (ttabel) is 2.005, with a significance level of 0.108. Since thitung (1.635) < ttabel (2.005) and significance (0.108) > 0.05, workload does not have a partial effect on turnover intention, leading to the rejection of hypothesis H2. However, for job stress, the calculated t-value (thitung) is 2.577, while the table t-value (ttabel) is 2.005, with a significance level of 0.013. Since thitung (2.577) > ttabel (2.005) and significance (0.013) < 0.05, job stress has a positive and significant partial effect on the turnover intention of employees at PT. Nippo Mechantronics Indonesia, resulting in the acceptance of hypothesis H3.The adjusted R-square value of 0.432 represents the coefficient of determination, meaning that 43.2% of turnover intention can be explained by work conflict, workload, and job stress. Universitas Mercu Buana 2025-07-28 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32374 10.22441/jimb.v11i2.32374 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 2 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 158-173 2655-7274 2460-8424 10.22441/jimb.v11i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32374/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/32374/8261 Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3509 2018-08-24T07:02:51Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/27030 2024-08-19T02:20:46Z jimb:ART driver

Implementation of Association Rule Market Basket Analysis to Increase Sales Through Product Bundling Strategy at the Fashion Online Store Buana, Arga Vikaliana, Resista Athaku Online Store is an fashion online store that sells baby clothes and children's t-shirts by offering free design of images and writing on the products. The increase in the number of online stores has caused competition between online stores to become tighter, so that online stores need to develop business strategies by paying attention to consumer behaviour (Customer Relationship Management) which can be used as a basis to increase sales through product bundling strategies. The goal to be achieved in this research is to get an overview of the associations between products which will be used as a basis for making product recommendations to increase sales at the Athaku Online Store using data mining, namely association rules using an a priori algorithm. By collecting transaction data by consumers starting from January 1 to 30 September 2022 with a total of 4,229 transactions, analysis of the transaction data was carried out using a minimum support value of 0.15 and a minimum confidence value of 0.5 so that the results were obtained, namely 3 product association rules, which then validated the recommendations. by distributing questionnaires to 30 consumers of the Athaku online store. The product association rules that have been validated can be used as a basis for determining product bundling strategies in the Athaku online store. From the research results, it is known that there is an opportunity to increase sales for three products, namely Jumpers, Bloomers, and Bibs. Universitas Mercu Buana 2024-08-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/27030 10.22441/jimb.v10i2.27030 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 2 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 171-185 2655-7274 2460-8424 10.22441/jimb.v10i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/27030/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6994 2020-07-27T02:42:04Z jimb:ART driver

Pengaruh Kompensasi, Disiplin Kerja, Dan Lingkungan Kerja Fisik Terhadap Kinerja Karyawan Pada Pos Kota Jakarta wibowo, mas wahyu Compensation, Work Discipline; Physical Work Environment; Performance The purpose of this study is to analyze the influence of compensation, work discipline and physical work environment on employee performance in the Pos Kota Office Jakarta on 2017th. The result of the research by using primary data in the form of questionnaires to 102 employees in Pos Kota Office Jakarta with Probability Sampling (Simple Random Sampling) method. shows that the compensation, work discipline, and physical work environment showing a positive and significant impact on employee performance. There is a positive and significant influence between compensation, work discipline, and physical work environment seen from the analysis of comparative linear regression calculation has a regression coefficient of 0.273, the work discipline has a regression coefficient of 0.304 and the physical work environment has a regression coefficient of 0.403, it indicates that compensation , work discipline and a good physical work environment will improve the performance of  Pos Kota Employee. The results shows that the compensation, work discipline, and physical work environment that has been given by Pos Kota Office has done well in accordance with their respective objectives and can be responded well by the employee. High performance of Pos Kota employee indicates that Pos Kota Office is able to control the work performance of Pos Kota employee based on the benefits received so Pos Kota employee are able to do the job according to their respective responsibilities Universitas Mercu Buana 2019-12-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6994 10.22441/jimb.v5i3.6994 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 3 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 215-225 2655-7274 2460-8424 10.22441/jimb.v5i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6994/2988 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/14417 2022-10-07T09:28:10Z jimb:ART driver

Strategy Selection in the Implementation of PT Kereta Commuter Indonesia's Security Management System in The Greater Jakarta Area Ridwan, Mohammad Hidayah, Zainur Ramly, Amir Tengku security management, Analytical Hierarchy Process, transportation management, commmuter train, Indonesia The purpose of this study is to describe a general description of the conditions of Security Management System (SMS) implementation in the PT KCI Greater Jakarta area, examine indicators that can affect the implementation of SMS at PT KCI Greater Jakarta area, and formulate a priority scale strategy for SMS at PT KCI Greater Jakarta area during the COVID-19 pandemic. The researcher uses Analytical Hierarchy Process (AHP) method by including six indicators of field certification, employee skills training, reporting & administration, archive documentation, and performance evaluation as the selection of indicators that affect implementation, and three alternative selection strategies, namely training competencies, documentation & records, and controls & processes. The results showed that the most influential indicators were the Documentation Archive 0.331, Reporting & Administration 0.223, and Operational Control 0.203, while the appropriate alternative strategies to determine steps in implementing SMS during the covid-19 pandemic were Documentation & Records 0.594 and control and process 0.262. The results imply that to achieve the successful implementation of the SMS program at PT KCI, a document filing system and good operational control are needed in each security unit. Universitas Mercu Buana 2022-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14417 10.22441/jimb.v8i1.14417 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 1 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 138-148 2655-7274 2460-8424 10.22441/jimb.v8i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14417/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/14417/2995 Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/15448 2023-11-30T15:11:24Z jimb:ART driver

Analysis of Regional Expenditure in the Government for the 2020 Financial Year Mutiarin, Dyah Misran, Misran Syahputra, Dicky Izmi Financial Performance; Regional Spending; Cost Management. This study aims to find out the analysis of local government spending in DKI Jakarta Special Region of Yogyakarta, Banda Aceh City, Papua, West Papua for the 2020 Fiscal Year in managing the 2018-2020 regional budget. This research is descriptive. The results of the study show that the spending variance of the Regional Government Expenditures (DKI Jakarta, DIY, Banda Aceh City, Papua, and West Papua) in 2018-2020 is an average of 25.5% -27.7% included in the favorable category variance because the realization of expenditure does not exceed the set budget. Furthermore, from the Harmony Ratio, most regional expenditures are allocated for Operational Expenditures. The average operating expenditure in 2018-2020 is 33.35%, while capital expenditure is 40.16%. The average is taken from the percentage of the five regional governments, and the Regional Expenditure Efficiency Ratio shows that the realization of the expenditure budget never exceeds the budget. The average efficiency ratio is 2018-2020 is 80.88%. This shows that the five regional governments are pretty efficient in making savings or spending efficiency. Universitas Mercu Buana 2023-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15448 10.22441/jimb.v9i1.15448 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 1 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 150-161 2655-7274 2460-8424 10.22441/jimb.v9i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15448/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/15448/3100 Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3702 2018-09-03T06:58:47Z jimb:ART driver

PENGARUH CITRA MEREK DAN GAYA HIDUP TERHADAP KEPUTUSAN PEMBELIAN PRODUK TAS BRANDED TIRUAN PADA WANITA KARIR DI JAKARTA Prasetyaningsih, Erlita Astini, Rina Career Woman; Brand Image; Lifestyle; Purchase Decisions; Women aren’t spared from the development of fashion and trends that occur around them. Especially thefashiontrends,theproducerscreateproductsthatcanattractcareerwomen.Thisisbecausecareerwomenhave more ability to buy goodsthat canimprove herclass.This researchaims todeterminethe influenceofbrand image and lifestyle on purchasing decisions imitation branded bags on the career woman in Jakarta.The population in this research is the career woman who likes to use a branded bag. Samples used were asmany as 100 people. The sampling technique using is purposive sampling. To answer the problemformulation,purposeandhypothesisofthisstudy,theanalysisemployedisIBMSPSSVer.21.0.Basedontheanalysis IBMSPSS Ver. 21.0 can be concluded that brand image have positive and significant impact onpurchasingdecisions.Thenlifestylehaspositiveandsignificantimpactonpurchasingdecisions. Universitas Mercu Buana 2016-07-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3702 10.22441/jimb.v2i2.3702 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 2 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 626-640 2655-7274 2460-8424 10.22441/jimb.v2i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3702/1911 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/583 2018-09-03T03:15:44Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/573 2018-09-03T02:57:19Z jimb:ART driver

PENGARUH CITRA MEREK DAN GAYA HIDUP TERHADAP KEPUTUSAN PEMBELIAN PRODUK TAS BRANDED TIRUAN PADA WANITA KARIR DI JAKARTA Prasetyaningsih, Erlita Sukardiman, Diah Fistiani Women aren’t spared from the development of fashion and trends that occur around them. Especially the fashion trends, the producers create products that can attract career women. This is because career women have more ability to buy goods that can improve her class. This research aims to determine the influence of brand image and lifestyle on purchasing decisions imitation branded bags on the career woman in Jakarta. The population in this research is the career woman who likes to use a branded bag. Samples used were as many as 100 people. The sampling technique using is purposive sampling. To answer the problem formulation, purpose and hypothesis of this study, the analysis employed is IBMSPSS Ver. 21.0. Based on the analysis IBMSPSS Ver. 21.0 can be concluded that brand image have positive and significant impact on purchasing decisions. Then lifestyle has positive and significant impact on purchasing decisions.Keyword: Career Woman, Brand Image, Lifestyle, Purchase Decisions Universitas Mercu Buana 2016-05-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/573 10.22441/jimb.v1i3.573 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 3 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 323-336 2655-7274 2460-8424 10.22441/jimb.v1i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/573/503 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/32367 2025-04-10T02:03:31Z jimb:ART driver

Integration of Digital Technology and Green Human Resource Management (GHRM) in Aligning Equity Principles to Drive Innovation, Employee Development, and Environmental Sustainability Al Alaq, Ameera Sahar Damayanti, Adinda Oktaviana Efendi, Doni Tahara, Ghina Thalita Setyawati, Novita Environmental Sustainability; Green Human Resource Management (GHRM); Industry 4.0 Technology; Organizational Transformation; Responsible Digitalization The integration of digital technology in the era of Industry 4.0, such as artificial intelligence (AI) and machine learning (ML), has driven green innovation in the manufacturing sector, improving operational efficiency, financial performance, and reducing environmental impact. However, the uneven distribution of sustainability benefits remains a challenge that requires strategic solutions. This study aims to analyze how the application of equity principles in Green Human Resource Management (GHRM) can mediate the relationship between digital technology and organizational sustainability. The study employs a literature-based methodology with research result reporting to examine the contribution of equity-based GHRM in supporting organizational sustainability. Relevant literature is identified and analyzed to explore the role of equity principles in providing equal access to green training, skill development, and the distribution of sustainability benefits. This methodology enables a comprehensive understanding of the relationship between GHRM, digital technology, and sustainability. The findings indicate that equity principles in GHRM enhance employee engagement and commitment to green initiatives through an inclusive and collaborative work environment. Digital technologies such as E-HRM and AI facilitate efficient green training, reduce carbon footprints, and strengthen organizational competitiveness. This approach also addresses gaps in access to training and development, reinforces an environmentally friendly work culture, and boosts employee productivity. In conclusion, integrating equity principles into GHRM and leveraging digital technologies create a strategic approach to achieving environmental, social, and economic sustainability. This study highlights the importance of combining equity and technology in building a holistic, progressive, and inclusive sustainability strategy to address future global challenges.  Universitas Mercu Buana 2025-04-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32367 10.22441/jimb.v11i1.32367 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 1 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 64-75 2655-7274 2460-8424 10.22441/jimb.v11i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32367/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3498 2018-08-24T07:02:50Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/24864 2024-03-31T13:25:30Z jimb:ART driver

Driving Towards Digitalization and Industry 4.0 in the Coal Mining Sector Ayeisha, Bthari Anggoro, Yudo Digitalization; Coal Mining; Operational Efficiency; Industry 4.0; IoT; Data Analytics; Automation; Employee Training; This research provides an in-depth analysis of the impact of digitalization on the coal mining sector, with a special focus on PT X. The study employs a combination of content analysis, narrative analysis, and business solution mapping to extract insights from interviews conducted with five key stakeholders at PT. X. The objective is to assess how technological advancements can elevate operational efficiency and competitiveness in the era of Industry 4.0, and to identify strategies for effectively reducing reliance on human resources in site monitoring, while ensuring employee satisfaction and smooth transition. Through the methodological triangulation of content and narrative analysis, the study distils crucial themes and perspectives from the interviews. It identifies that the integration of advanced technologies like IoT, data analytics, and automation is vital for enhancing operational efficiency and reducing operational downtime. The research highlights the importance of transitioning from manual to automated site monitoring, emphasizing the adoption of drones and automated systems to bolster operational accuracy and efficiency. A key finding of the study is the identification of potential obstacles in digital technology investment, such as cost, system integration challenges, and employee resistance to new technologies. The study suggests that overcoming these barriers requires effective communication strategies and comprehensive training programs for employees. Drawing on the successful digital transformation strategies of companies like Adaro, the research recommends that PT. X should adapt similar strategies, customized to its unique challenges and context. The study contributes valuable insights into the digital transformation process in the coal mining sector, offering practical recommendations for companies like PT. X navigating the complex landscape of Industry 4.0. Universitas Mercu Buana Yudo Anggoro, SBM ITB 2024-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/24864 10.22441/jimb.v10i1.24864 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 1 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 38-52 2655-7274 2460-8424 10.22441/jimb.v10i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/24864/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6842 2019-09-05T10:07:57Z jimb:ART driver

PENGARUH KOMPENSASI, PELATIHAN DAN MOTIVASI TERHADAP KINERJA FRONTLINER PADA PT BANK RAKYAT INDONESIA (PERSERO), TBK CABANG BEKASI Ekhsan, Muhamad Kompensasi, Pelatihan, Motivasi, dan kinerja Penelitian ini bertujuan untuk menguji dan menganalisis pengaruh kompensasi , pelatihan dan motivasi terhadap kinerja frontliner pada PT Bank Rakyat Indonesia cabang Bekasi. Pengumpulan data dilakukan dengan penyebaran kuesioner dengan jumlah sampel sebanyak 73 responden dan dengan menggunakan pendekatan deskriptif kuantitatif. Karena itu, analisis data yang digunakan adalah analisis statistik dalam bentuk uji regresi linier berganda. Hasil penelitian ini menunjukkan bahwa secara parsial dan simultan variabel kompensasi, pelatihan dan motivasi berpengaruh terhadap kinerja frontliner pada PT Bank Rakyat Indonesia Cabang Bekasi. Hal ini dibuktikan dari hasil uji simultan (Uji F) dan hasil Uji Parsial (Uji t) juga menunjukkan nilai signifikan dari tiga variabel bebas yang mendukung hipotesa. Oleh karena itu hasil uji dari penelitian ini menyatakan bahwa terdapat pengaruh secara simultan antara variabel kompensasi, pelatihan dan motivasi terhadap Kinerja Frontliner Pada PT Bank Rakyat Indonesia Cabang Bekasi Universitas Mercu Buana 2019-09-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6842 10.22441/jimb.v5i2.6842 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 2 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 249 - 265 2655-7274 2460-8424 10.22441/jimb.v5i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6842/2879 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/13636 2022-10-07T09:28:10Z jimb:ART driver

The Analysis of Factors Affecting Work Performance of Employees (Case Study at The Production Department of PT Yahata Fastener Indonesia) Affini, Dinar Nur Farida, Arwi Handiman, Unang Toto Sutawidjaya, Ahmad Hidayat job training; physical work environment; financial compensation; work performance This study aims to analyze the factors that affect employees' work performance in the production department of PT. Yahata Fastener Indonesia. The population in this study were all employees of the production department of PT. Yahata Fastener Indonesia. The sample used is a saturated sample that is as many as 50 respondents using. Methods of data collection using survey methods, with the research instrument is a questionnaire. Data analysis this study uses SPSS 22. The result of this study is that job training has a positive and significant effect on employees' work performance in the production department of PT. Yahata Fastener Indonesia. In addition, the physical and work environment has a positive and significant impact on the employees' work performance of the production department of PT. Yahata Fastener Indonesia. Finally, financial compensation has a positive and significant effect on employees' work performnace in the production department of PT. Yahata Fastener Indonesia. Universitas Mercu Buana 2022-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13636 10.22441/jimb.v8i1.13636 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 1 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 1-15 2655-7274 2460-8424 10.22441/jimb.v8i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13636/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/13774 2023-11-30T15:11:24Z jimb:ART driver

Analysis of The Effect of Product, Price, Promotion, And Location on Customer Loyalty of Tenun Ikat Tang, Sefnat Aristarkus Maro, Yustina Loyalitas pelanggan, produk, harga, promosi, lokasi This study aims to determine the effect of the product, price, promotion, and location on customer loyalty of ikat in Baranusa Village, Pantar Barat District, Alor Regency, either partially or simultaneously. Customer loyalty is a positive attitude shown by customers towards goods or services by repurchasing the products or services offered by the company and recommending them to friends and family. Loyal customers can indirectly help companies promote products or services to those closest to them.Data was collected using a questionnaire using 30 respondents. Data analysis used descriptive statistics, research instrument tests, multiple linear regression, t-test, and F test. The results showed that partially the product had a significant positive effect on customer loyalty, the price had a significant positive effect on customer loyalty, and the promotion had a significant positive effect on customer loyalty. , and location have a significant positive effect on customer loyalty. Simultaneously product, price, promotion, and location have a significant positive effect on customer loyalty. Universitas Mercu Buana 2023-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13774 10.22441/jimb.v9i1.13774 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 1 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 1-25 2655-7274 2460-8424 10.22441/jimb.v9i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13774/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/13774/2618 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/13774/2619 Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/37188 2026-04-04T08:45:13Z jimb:ART driver

The Interplay of Culture and Compensation: How Financial Rewards Impact Engagement in the Public Sector? Mdhlalose, Dickson Culture, Employee Engagement, Financial Rewards, Public Sector Cultural research on the influence of individuality and collectivism on employee engagement is lacking. This study aims to analyse the impact of employee financial rewards on employee engagement, focusing on individualistic and collectivistic cultures as moderating variables in a public sector organisation. This research employed standardised face-to-face open-ended interviews. The research instrument is made from one theme and five open-ended questions to address the objectives of this study. The constantcomparative dataanalysis approach was employed inconjunction with content analysis. The researcher categorised the data based on their disparities and similarities. This study found that the municipality offers its employees financial rewards; however, due to inequality, unfairness, favouritism, and political influence, employees are not rewarded fairly, leading to unhappiness and disengagement from their work and the organisation. The municipality does not practice either a collectivistic or individualistic culture. A poor imbalance between individualistic and collectivistic cultures reduces the impact of financial rewards on employee engagement. This study's findings emphasise that the effectiveness of monetaryrewardsonemployeeengagementdependsontheorganisation's practicesandtheequilibriumofindividualisticandcollectivisticcultures. Universitas Mercu Buana 2026-04-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/37188 10.22441/jimb.v12i1.37188 Jurnal Ilmiah Manajemen dan Bisnis; Vol 12, No 1 (2026): Jurnal Ilmiah Manajemen dan Bisnis; 38-37 2655-7274 2460-8424 10.22441/jimb.v12i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/37188/pdf Copyright (c) 2026 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/4397 2018-11-19T06:51:12Z jimb:ART driver

PENGARUH KETERIKATAN KERJA,JENJANG KARIR DAN STANDAR PELATIHAN TERHADAP KINERJA KARYAWANPADA PT. BANK RAKYAT INDONESIA (PERSERO) TBK KANTOR WILAYAH JAKARTA 1 STATUS PEGAWAI TETAP Soelton, Mochamad Gustiawan, Iwan Fazriyanti, Laila keterikatan kerja; jenjang karir; standar pelatihan; kinerja karyawan; Penelitian ini untuk mengetahui pengaruh keterikatan kerja, jenjang karirdan standarpelatihanterhadap kinerja karyawan PT. Bank Rakyat Indonesia (Persero) wilayah Jakarta1. Objek penelitian ini adalah karyawan yang bekerja pada PT. Bank Rakyat Indonesia(Persero) wilayah Jakarta 1.Penelitian ini dilakukan terhadap 85 responden dengan menggunakan pendekatan deskriptif kuantitatif. Karena itu, analisis data yang digunakan adalah analisis statistik dalam bentuk uji regresi linear berganda.Hasil penelitian ini menunjukkan bahwa secara parsial dan simultan, variabel keterikatan kerja, jenjang karir dan standar pelatihan terhadap kinerja karyawan padaPT. Bank Rakyat Indonesia (Persero) Wilayah Jakarta 1. Hal ini dibuktikan dari hasil uji simultan (uji F) dan hasil uji parsial (uji t) juga menunjukkan nilai signifikan dari tiga variabel bebas yang mendukung hipotesa. Hasil uji dari penelitian ini menyatakan bahwa terdapat pengaruh secara simultan antara keterikatan kerja, jenjang karir dan standar pelatihan terhadap kinerja karyawan PT. Bank Rakyat Indonesia (Persero) Wilayah Jakarta 1. Universitas Mercu Buana 2018-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4397 10.22441/jimb.v4i1.4397 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 1 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 21-38 2655-7274 2460-8424 10.22441/jimb.v4i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4397/2162 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/10100 2020-12-15T10:40:37Z jimb:ART driver

Pengaruh Abusive Supervision Terhadap Turnover Intention Karyawan Hotel Dewi, Triana Rosalina Pramanik, Purwanti Dyah Sihite, Janfry Meskipun sebagian besar operasional pekerjaan rutin pada berbagai bisnis telah tergantikan oleh teknologi, namun pada bisnis perhotelan masih membutuhkan sejumlah orang untuk menyelesaikan pekerjaan operasionalnya. Ciri khas industri perhotelan adalah pada jam kerja operasionalnya. Bisnis hotel buka 24 jam dan berusaha sangat efisien dalam mempekerjakan orang. Jumlah orang terbatas, dan biasanya dibagi secara bergiliran. Karyawan yang terbatas itu harus melayani tamu tanpa keluhan. Kondisi ini menimbulkan tekanan bagi atasan, sehingga dapat menimbulkan sikap kurang menyenangkan atasan untuk mencapai kinerja yang sangat baik. Penelitian ini bertujuan untuk menganalisis dampak sikap kurang menyenangkan atasan terhadap keterikatan kerja karyawan hotel di Jakarta. Penelitian ini menggunakan pendekatan deskriptif kuantitatif. Karyawan hotel dipilih sebagai responden dengan convenience sampling. Responden diminta untuk mengisi kuesioner mengenai profil mereka dan persepsi mereka tentang sikap kurang menyenangkan atasan serta dampaknya terhadap niat karyawan untuk mengundurkan diri. Analisis data menggunakan uji validitas dan reliabilitas, deskriptif (frekuensi dan mean), dan uji regresi linier sederhana. Hasilnya adalah terdapat pengaruh positif dan signifikan dari sikap kurang menyenangkan atasan terhadap niat karyawan untuk mengundurkan diri dari hotel di Jakarta. Kata kunci: sikap kurang menyenangkan atasan, niat untuk mengundurkan diri, karyawan, hotel Universitas Mercu Buana 2020-12-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10100 10.22441/jimb.v6i3.10100 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 3 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 384 - 392 2655-7274 2460-8424 10.22441/jimb.v6i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10100/4001 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3528 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/564 2018-08-25T04:29:54Z jimb:ART driver

KAJIAN KRITIS MENGENAI DEFINISI DAN RUANG LINGKUP SALESMANSHIP Setiawan, Deva Prudensia Word of salesmanship is not widely used. This is a relatively new word in the vocabulary of Indonesian people and are not widely used in the English language literature. In addition, there is a tendency of people hesitate to use this word salesmanship. Doubt is due to ambiguities in the definition and scope of the word indicated by the various definitions vary in meaning and scope. Perhaps, too, there are many people who see the meaning of this word is so trivial and narrow in scope because many people who use this word gives the sense in the context of the narrow sense. Thus, this word sounds too sophisticated for ordinary purposes. We need to see and examine with a critical sense of the word and put it in its rightful place and that we needKeywords : Sales, service, salesmenship Universitas Mercu Buana 2016-05-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/564 10.22441/jimb.v1i1.564 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 1 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 86-91 2655-7274 2460-8424 10.22441/jimb.v1i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/564/495 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/28021 2024-12-05T03:27:30Z jimb:ART driver

An Analysis of the Effects of Investment Decisions, Funding Decisions, and Dividend Policies on Firm Value Zaldi, Shadhwina Nabilah, Aisyah Apribi, Cika Tri Zainab, Siti Investment decisions; funding decisions; dividend policies; firm value The global economy is still experiencing instability in the capital market. Several factors cause capital market instability. One of the factors that affect the capital market is financial information. Financial information can affect stock prices and overall company value. This study aims to analyze the effect of investment decisions, funding decisions, and dividend policies on firm value. The method used uses quantitative methodology with an associative approach. The population of this study are public companies listed on the Bursa Efek Indonesia with Food and Beverages companies as samples. The sampling method used is purposive sampling method. Samples were collected from 8 Food and Beverages companies listed on the Bursa Efek Indonesia during 2017—2023. The data analysis technique uses the classical assumption test, multiple linear regression equation, coefficient of determination (R² test), and hypothesis testing. The results show that: (1) Investment decisions influence firm value; (2) Funding decisions have no effect on firm value; (3) Dividend policies has no effect on firm value; and (4) Investment decisions, funding decisions, and dividend policies have an influence on firm value with an influence of 40.3%. Universitas Mercu Buana 2024-12-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/28021 10.22441/jimb.v10i3.28021 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 3 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 362-374 2655-7274 2460-8424 10.22441/jimb.v10i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/28021/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/28021/6681 Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/15796 2022-12-15T10:40:39Z jimb:ART driver

Marketing Risk Management and Mapping Based on Geographic Information System in The Micro, Small, and Medium Enterprise in Tasikmalaya City Maesaroh, Syti Sarah Swardana, Ardli Nuryadin, Asep Herdiana, Oding Rahatuningtyas, Risma Digital; Management; Mapping; Marketing; Risk The current COVID-19 pandemic has greatly impacted the economic sector, especially Micro, Small, and Medium Enterprises (MSMEs). Restrictions on physical mobility hinder the marketing of MSMEs’ products, which is usually carried out directly. This is one of the important risks to be studied in depth. The purpose of this study is to determine the management system and mapping of marketing risks in MSMEs in Tasikmalaya City. The research method used in this study was descriptive quantitative. Data were collected through a closed questionnaire that was given to MSMEs. The obtained data were processed through a risk management system approach and then mapped using a Geographical Information System (GIS). The results showed that the highest marketing risks for MSMEs in Tasikmalaya City are increasingly fierce business competition, nonoptimal internet usage, and limited marketing coverage. Geographically, the level of marketing risks of MSMEs in Tasikmalaya City is in the medium category. Geographical marketing risk mapping can determine the most appropriate recommendations to deal with various risks faced according to regional characteristics. Universitas Mercu Buana Universitas Pendidikan Indonesia 2022-12-15 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15796 10.22441/jimb.v8i3.15796 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 3 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 319-330 2655-7274 2460-8424 10.22441/jimb.v8i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15796/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/15796/3209 Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/24522 2023-12-16T07:26:04Z jimb:ART driver

Promotion Mix Of E-Catalog at Deputy Coordination Of Regional Development And Spatial Planning, Coordinating Ministry For Economic Affairs Murtinah, Tintin Sri Wijayanti, Ritma promotion mix, E-Catalog, Commitment Officer, Procurement Deputy Coordination of Regional Development and Spatial Planning was a part of unit in Coordinating Ministry for Economic Affairs. Implementation of Procurement of Goods/Services to Deputy Coordination of Regional Development and Spatial Planning through E-Catalogs is still not optimal. This study aims to determine Promotion Mix of E-Catalog at Deputy Coordination of Regional Development and Spatial Planning, Coordinating Ministry for Economic Affairs. This research was conducted using a descriptive method with a qualitative approach. Data collection techniques were carried out by documents review and interviews. Data analysis was carried out by matching data from document reviews and interviews to describe the results of the research. Based on the three aspects measured, namely the sales promotion aspect, the publicity aspect, and the personal selling aspect which shows that Promotion Mix of E-Catalog at Deputy Coordination of Regional Development and Spatial Planning, Coordinating Ministry for Economic Affairs, has not gone well yet. The results of interviews and document review concluded that: first, the price offered in the E-Catalog tends to be higher than the direct procurement process. Second, the items contained in the E-Catalog were incomplete and the information contained in the E-Catalog was still difficult to understand. Third, the menus in the E-Catalog were still unfamiliar so they were not user friendly. As an effort to optimize the promotion mix at E-Catalog to the Deputy for Coordination of Regional Development and Spatial Planning, the Coordinating Ministry for Economic Affairs, the author suggested several things as follows: Carry out the procurement of commodities/services at the beginning ; Be more selective in determining the specifications of commodities/services, especially if the price offered on the E-Catalog is more expensive; Complete the existing processes in the E-Catalog to completion; Understand the information contained in the E-Catalog; Be more selective in finding the commodities according to the required specifications; Adapt to implement the procurement of commodities/services through ecatalogs; Increase the office bandwidth capacity. Universitas Mercu Buana 2023-12-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/24522 10.22441/jimb.v9i3.24522 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 3 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 416-424 2655-7274 2460-8424 10.22441/jimb.v9i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/24522/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5626 2019-12-12T10:28:12Z jimb:ART driver

PENGARUH GAYA KEPEMIMPINAN DIREKTIF DAN DISIPLIN KERJA TERHADAP KINERJA KARYAWAN (Studi Kasus Pada PT NIPSEA PAINT AND CHEMICALS di JAKARTA) Sutrisno, Atik Mustafidah Gaya Kepemimpinan Direktif, Disiplin Kerja, Kinerja Karyawan Penelitian ini bertujuan untuk menguji dan menganalisis pengaruh gaya kepemimpinan direktif, dan disiplin kerja terhadap kinerja karyawan PT. NIPSEA PAINT AND CHEMICALS di Jakarta. Pengumpulan data dilakukan melalui penyebaran kuesioner dengan jumlah sampel sebanyak 67 responden dan dengan menggunakan pendekatan deskriptif kuantitatif. Karena itu, analisis data yang digunakan adalah analisis statistik dalam bentuk uji regresi linier berganda. Hasil penelitian ini menunjukkan bahwa secara parsial dan simultan variabel Gaya Kepemimpinan Direktif dan Disiplin Kerja berpengaruh terhadap Kinerja Karyawan pada PT NIPSEA PAINT AND CHEMICALS JAKARTA. Hal ini dibuktikan dari hasil uji simultan (Uji F) dan hasil Uji Parsial (Uji t) juga menunjukkan nilai signifikan dari dua variabel bebas yang mendukung hipotesa. Oleh karena itu hasil uji dari penelitian ini menyatakan bahwa terdapat pengaruh secara simultan antara variabel Gaya Kepemimpinan Direktif dan Disiplin Kerja terhadap Kinerja Karyawan Pada PT Nipsea Paint And Chemicals Jakarta. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5626 10.22441/jimb.v5i1.5626 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 1 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 62 - 77 2655-7274 2460-8424 10.22441/jimb.v5i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5626/2565 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/11567 2021-11-30T15:43:04Z jimb:ART driver

The Effect of e-WOM, Security and Trust on Purchasing Decisions of Green Lake City Housing Samudro, Amzad Hamdan, Hamdan e-WOM, Purchasing Decisions, Security, Trust This research is about purchasing decisions for Green Lake City housing and this study aims to see the effect of e-WOM, Security and Trust on Purchasing Decisions of Green Lake City Housing and respondents who are owners of Green Lake City housing. This research is descriptive quantitative. Primary data and secondary data were obtained. Secondary data were obtained from various sources such as journalists, books and other related publications primary data obtained by distributing questionnaires to respondents. Determination of the number of samples using purposive sampling technique and will be displayed via google form to a minimum of 150 respondents. The results showed that e-WOM has a significant positive relationship with purchase decisions, security has a significant negative relationship with purchasing decisions, and trust has a significant positive relationship with purchasing decisions Universitas Mercu Buana Biro Penelitian, Pengabdian Masyarakat dan Publikasi Universitas Mercu Buana 2021-11-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11567 10.22441/jimb.v7i3.11567 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 3 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 312-323 2655-7274 2460-8424 10.22441/jimb.v7i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11567/4939 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/33721 2025-12-04T03:24:26Z jimb:ART driver

Understanding Green Product Purchase Decisions Among Generation Z in Indonesia: An Analysis Using Structural Equation Modelling Azhari, Sulaiman Albana, Abduh Sayid Zunaidi, Rizqa Amelia Green Product; Generation Z; Purchase Decision; Structural Equation Modelling; Utility Indonesia faces significant environmental challenges, with plastic waste pollution remaining a major issue. To address this, businesses are increasingly offering green products, yet consumer adoption—especially among Generation Z—remains limited. This study aims to identify the key factors influencing green product purchase decisions among Generation Z in Indonesia. A quantitative approach was employed, collecting data from 500 Gen Z respondents who have experience using green products. Structural Equation Modeling (SEM) was used to analyze the relationships among variables, including green attitude, green value, green knowledge, price, performance, convenience, preference, perception, purchase decision, and utility. The results show that green value, green knowledge, and performance significantly influence preferences and perceptions, which in turn positively affect purchase decisions and perceived utility. However, green attitude, price, and convenience do not have a significant direct effect. These findings suggest that increasing green value, knowledge, and product performance can enhance green product adoption among Indonesian youth. The study provides practical insights for companies and policymakers to design more effective strategies targeting Generation Z consumers and contributes to the broader understanding of sustainable consumption behavior in emerging markets. Universitas Mercu Buana 2025-11-29 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33721 10.22441/jimb.v11i3.33721 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 3 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 293-305 2655-7274 2460-8424 10.22441/jimb.v11i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33721/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3836 2018-09-08T02:09:05Z jimb:ART driver

PENGARUH PENERAPAN KAIZEN DAN DISIPLIN KERJA TERHADAP KINERJA KARYAWAN DI DEPARTEMEN CUSTOMER SERVICE PT BCA FINANCE Soelton, Mochamad Rahmi, Rizky Andrafiana Kaizen; Work Dicipline; Employee Performance; he research is to determine the affect of Kaizen and work dicipline to employee performance. Theobject for this research is employee of Customer Service Department in PT BCA Finance. The research wasdone to 72 respondents consist of staff and team leader. The research using quantitative-descriptiveapproach with Non Probability Sampling method using Convenience Sampling. Data collected byquestionnaire and the data analyzed using multiple linier regressio. Data processing for statistical tests performed by software SPSS version 20.The results of the research indicate that in partially, Kaizen has not significant influence on employee performance but work dicipline has significant influence on employee performance of Customer ServiceDepartment in PT BCA Finance Universitas Mercu Buana 2016-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3836 10.22441/jimb.v2i3.3836 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 3 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 864-881 2655-7274 2460-8424 10.22441/jimb.v2i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3836/2009 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3980 2019-07-05T15:33:14Z jimb:ART driver

PENGARUH BUDAYA ORGANISASI DAN GAYA KEPEMIMPINAN TERHADAP KINERJA KARYAWAN Sihombing, Lukertina budaya organisasi; gaya kepemimpinan; kinerja karyawan Pangsa pasar nutrition food di Indonesia terus menunjukkan potensi pertumbuhan yang positif. Gizi buruk dan kekurangan gizi, berpengaruh erat pada kualitas sumber daya manusia. Kinerja organisasi salah satu nutrition food company yang unggul ini diharapkan sebanding dengan kinerja karyawannya. Penelitian ini menguji dan menganalisis pengaruh budaya organisasi dan gaya kepemimpinan terhadap kinerja karyawan PT.SA. Populasi penelitian adalah seluruh karyawan pada divisi CRM, Manufakturing dan QA yaitu 250 orang. Metode Sampling yang digunakan adalah Probability Sampling, dengan teknik Proportionate Stratified Sampling menggunakan rumus Slovin, maka ditemukan 154 karyawan atau responden sebagai sampel. Teknik pengumpulan data menggunakan instrumen kuesioner. Analisa data menggunakan teknik regresi linier berganda melalui SPSS versi 21, dan hasil penelitian menunjukkan adanya pengaruh positif yang signifikan antara budaya organisasi terhadap kinerja karyawan dan gaya kepemimpinan terhadap kinerja karyawan secara parsial, serta adanya pengaruh positif yang signifikan secara bersama-sama pada  kedua variabel terhadap kinerja karyawan. Gaya Korelasi sangat kuat terjadi antara dimensi transformational leadership style dari variabel gaya kepemimpinan dengan dimensi work quantity  dari variabel kinerja karyawan. Pelatihan kepemimpinan secara berkala untuk level basic (staff) baik untuk membantu peningkatan kinerja karyawan secara personal maupun tim Universitas Mercu Buana 2018-11-14 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3980 10.22441/jimb.v4i2.3980 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 2 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 224-239 2655-7274 2460-8424 10.22441/jimb.v4i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3980/2243 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/8894 2020-12-15T10:49:05Z jimb:ART driver

ANALISIS FAKTOR YANG MEMPENGARUHI KEPUTUSAN PEMBELIAN PRODUK SKIN CARE Abdullah, Muhamad Al Faruq Persepsi Harga, Citra Merek, Keputusan Pembelian Penelitian ini bertujuan untuk mengetahui pengaruh persepsi harga dan citra merek terhadap keputusan pembelian Skincare. Objek penelitian ini adalah ibu rumah tangga di daerah Sawangan, Depok  yang pernah membeli produk skincare Marta Tilaar.  Variabel yang dipakai pada penelitian ini ada tiga, yaitu Persepsi Harga (X1), Citra Merek (X2) dan Keputusan Pembelian (Y). Penelitian ini dilakukan pada 110 responden secara offline kepada ibu rumah tangga di perumahan kawasan sawangan kota Depok. dengan menggunakan pendekatan kuantitatif. Teknik pengumpulan data yang digunakan adalah kuesioner dan menggunakan convenience sampling untuk pengambilan sampel. Analisis data yang digunakan adalah SEM dimana pengolahan data menggunakan program SmartPLS versi 3.0. Hasil penelitian menggambarkan bahwa variabel persepsi harga berpengaruh signifikan terhadap proses keputusan pembelian, kemudian variabel citra merek berpengaruh positif terhadap keputusan pembelian. Dari hasil penelitian ini, sebaiknya pihak produk dapat mempertahankan persepsi harga dan melakukan upaya pengembangan atau peningkatan citra merek, karena variabel persepsi harga dan citra merek memiliki pengaruh yang signifikan dalam mempengaruhi keputusan pembelian. Universitas Mercu Buana 2020-07-27 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8894 10.22441/jimb.v6i2.8894 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 2 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 254 - 262 2655-7274 2460-8424 10.22441/jimb.v6i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8894/3602 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3683 2018-09-03T02:35:02Z jimb:ART driver

ANTECEDENTS DAN CONSEQUENCES DARI ATTITUDE TOWARD POP-UP RETAIL Andriyani, Andriyani psychographic characteristics; behavioral intentions; beliefs; Pekan Raya Jakarta; The background of this research is to observe the impact of psychographic characteristics and behavioral intentions toward pop-up retail. The order of life is growing, consumers have a desire to increase the role ofself developed, innovate, and open-mindedness toward difference and unique experiences. Marketingenvironmental uniqueness that offered by pop-up retail can be attract consumer to find the difference wayand innovative experiences.The objectives of this research are to observe the impact of psychographic characteristics toward behavioralintentions through beliefs and attitude in Pekan Raya Jakarta pop-up retail.Structural Equation Model (SEM) method with parceling technique is used to analyzed the data of thisresearch. The data were collected by distributing closed questionnaires to Jakarta community respondents who ever visit into Pekan Raya Jakarta. There were 200 from 230 questionnaires data of respondent can beanalyzed in this research.The result of this research concludes that had any positive influence on psychographic characteristicsdimensions and beliefs although towards consumer attitude dan intention to patronage pop-up retail. Universitas Mercu Buana 2015-06-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3683 10.22441/jimb.v1i2.3683 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 2 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 225-244 2655-7274 2460-8424 10.22441/jimb.v1i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3683/1895 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3500 2018-08-24T07:02:50Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/14822 2022-08-02T07:18:30Z jimb:ART driver

The Influence Of Liquidity And Profitability On Stock Prices Of Food And Beverage Companies Listed In Indonesia Stock Exchange Loya, Ermelinda Suryanti Rahmawati, Christina Heti Tri Liquidity; Profitability; Stock Prices This study aims to determine if:1) liquidity and profitability simultaneously have a significant influence on stock prices of food and beverage companies listed in Indonesia Stock Exchange (IDX) for the 2015-2019 period, 2) liquidity partially has a significant influence on stock prices of food and beverage companies listed in IDX for the 2015-2019 period, 3) profitability partially has a significant influence on stock prices of food and beverage companies listed in IDX for the 2015-2019 period. The research population is 26 food and beverage companies listed in IDX for the 2015-2019 period. The research sample is 16 companies. The sampling technique used is purposive sampling. Data are obtained from the companies’ annual reports. The data analysis technique in this study is multiple linear regression analysis. The results of this study show that: 1) liquidity and profitability simultaneously have a significant influence on stock prices of food and beverage companies listed in IDX for the 2015-2019 period, 2) liquidity partially has no significant influence on stock prices of food and beverage companies listed in IDX for the 2015-2019 period, 3) partially profitability has a significant influence on stock prices of food and beverage companies listed in IDX for the 2015-2019 period. Universitas Mercu Buana Sanata Dharma University 2022-08-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14822 10.22441/jimb.v8i2.14822 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 2 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 203-217 2655-7274 2460-8424 10.22441/jimb.v8i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14822/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/14822/2902 Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/19811 2023-12-02T02:57:17Z jimb:ART driver

Optimizing The Role of Service Quality Towards Satisfaction Through Trust in BPJS Ketenagakerjaan Participants Safi'i, Tri Alfian Service Quality; Trust; Satisfaction; And Social Security. This study aims to analyze the effect of service quality and trust on the satisfaction of workers who have participated in the BPJS for Employment Sidoarjo Branch Office, as well as analyze the mediating role of trust in the effect of service quality on satisfaction. This research is a causal research with a quantitative approach. Collecting research data using a questionnaire distributed to formal and informal workers who have become members of the BPJS for Employment Sidoarjo Branch Office social security. Sampling using purposive sampling. Data analysis technique using PLS SEM analysis. The results of the study explain that service quality and trust have a positive effect on participant satisfaction at the BPJS for Employment Sidoarjo Branch Office. The results of the study also explain that trust can mediate the effect of service quality on participant satisfaction at the BPJS for Employment Sidoarjo Branch Office. These results explain that the better the quality of service from the BPJS for Employment and the better the level of trust from workers who are program participants will be able to increase the satisfaction of workers who are participants in the social security program. In addition, improving the quality of services that are getting better from BPJS for Employment staff will be able to increase company confidence in the services provided and then lead to higher satisfaction with employment social security services provided by BPJS for Employment. Universitas Mercu Buana 2023-08-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/19811 10.22441/jimb.v9i2.19811 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 2 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 204-217 2655-7274 2460-8424 10.22441/jimb.v9i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/19811/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5614 2019-05-07T05:59:51Z jimb:ART driver

MANAJEMEN RANTAI PASOK PRODUK BERAS RI1 ORGANIK ( STUDI KASUS PT. SWASEMBADA ORGANIS ) Fauziya, Lia Sitorus, Ediyanto Pengukuran Performansi, Supply Chain, Supply Chain Operation, Reference (SCOR), Analytical Hierarchy Process (AHP). PT. Swasembada Organis merupakan perusahaan yang belum pernah melakukan pengukuran kinerja secara sistematik menggunakan sistem pengukuran kinerja atau metode tertentu. Seiring berjalannya waktu banyak masalah yang terjadi di PT. Swasembada Organis yaitu mengalami masalah dalam kinerja supply chain nya, bahan baku yang di dapat dari supplier mengalami kendala sehingga mengakibatkan terlambatnya supply bahan baku perusahaan, sehingga berdampak kepada supply ke KFC yang terlambat. Di karenakan hal yang demikian sehingga kinerja supply chain managemnet nya tidak baik, sehinga perlu diadakan penelitian yang membahas tentang pengukuran kinerja supply chain management. Penelitian ini bertujuan untuk mengukur performa mana yang bermasalah dalam kinerja supply chain tersebut, dan kemudian menentukan strategi yang paling tepat untuk perbaikan kedepannya. Penulis menggunakan jenis penelitian deskriptif, dengan pendekatan kuantitatif. Metode yang digunakan untuk mengukur performa supply chain adalah Supply Chain Operations Reference (SCOR). Pengukuran performansi dalam penelitian ini juga didukung oleh metode Analytical Hierarchy Process (AHP) dengan diolah menggunakan alat sintesis atau software yaitu Expert Choice 2000. Hasil dari penelitian menunjukkan bahwa hasil analisis menggunakan metode AHP, yang menjadi alternative strategi atau pengukur kinerja utama adalah Stabilitas Produksi, Lead time pemenuhan pesanan, Keakuratan Persediaan, Kinerja Pengiriman dan Memenuhi Kebutuhan Pelanggan. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5614 10.22441/jimb.v4i3.5614 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 3 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 346 - 367 2655-7274 2460-8424 10.22441/jimb.v4i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5614/2554 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/4092 2019-07-05T15:08:02Z jimb:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/12064 2021-07-30T16:25:49Z jimb:ART driver

THE EFFECT OF RELATIVE ADVATAGE, CONSUMER INERTIA, AND SUBJECTIVE NORM ON SWITCHING INTENTION OF PAY-TV CONSUMERS Sulaiman, Dzikrina Azzukhruf Cici Artanti, Yessy Media hiburan di era digital tidak akan pernah berhenti, sebelumnya dari televisi analog dan radio, kini mengalami perkembangan dengan munculnya televisi berbayar seperti MNC Vision, podcast, video on demand langganan seperti Netflix, VIU, IQIYI, dll. bergeser dari media sebelumnya karena munculnya media yang lebih memuaskan. Penelitian ini merupakan penelitian kuantitatif yang bertujuan untuk menganalisis pengaruh keuntungan relatif, inersia konsumen, dan norma subjektif terhadap niat beralih. Responden adalah 200 konsumen TV berbayar MNC Vision. Pengambilan sampel penelitian menggunakan teknik non-probability dengan metode judgemental sampling. Pengolahan data melalui analisis regresi linier berganda. Variabel keunggulan relatif, inersia konsumen, dan norma subjektif berpengaruh signifikan terhadap niat beralih dari penelitian ini. Universitas Mercu Buana 2021-07-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12064 10.22441/jimb.v7i2.12064 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 2 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 197-211 2655-7274 2460-8424 10.22441/jimb.v7i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12064/4649 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3551 2018-08-25T05:35:19Z jimb:ART driver

PENGARUH GAYA KEPEMIMPINAN TRANSFORMASIONAL DAN DISIPLIN KERJA TERHADAP KINERJA PEGAWAI PADA PEGAWAI PADA DINAS PARIWISATA PEMUDA DAN OLAHRAGA KABUPATEN SERANG Permana, Angrian Puspa, Rani Listiawati, Listiawati Wahyudi, Wahyudi Transformational Leadership Style; Work Discipline; Employee Performance The variables in this study are Transformational Leadership Style (X1), Work Discipline(X2) and Employee Performance (Y). The purposes of this study are to know the influenceof transformational leadership style on employee performance, work discipline onemployee performance, and influence of transformational leadership style and workdiscipline on employee performance at the Department of Tourism, Youth and Sports ofSerang Regency. This research used questionnaires instrument to 34 employees at theDepartment of Tourism, Youth and Sports Serang Regency. The researcher used a tool,named SPSS 22 to get the result of the data. The researcher used it to get the result ofvalidity, reliability, classic assumption, simple regression, multiple regression, correlation,and hypothesis test. The result showed that the first variable (transformational leadershipstyle) has positive and significant influence on employee performance, the second variable(work discipline) has positive and significant influence on employee performance, and thelast result showed that transformational leadership style and work discipline has positiveand significant influence on employee performance at the Department of Tourism, Youthand Sports Serang Regency Universitas Mercu Buana 2018-08-24 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3551 10.22441/jimb.v3i1.3551 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 1 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 131-141 2655-7274 2460-8424 10.22441/jimb.v3i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3551/1885 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3858 2018-09-10T02:58:30Z jimb:ART driver

KEPEMIMPINAN TRANSFORMASIONAL DAN BUDAYA KERJA TERHADAP PENINGKATAN KUALITAS PELAYANAN PADA PERUSAHAAN DAERAH AIR MINUM KABUPATEN SUMEDANG (Studi Kasus Pada PDAM Tirta Medal Kabupaten Sumedang) Hidayat, Ardi Permana, Angrian Kepemimpinan Transformasional; Budaya Kerja; Kualitas Pelayanan; Penelitian ini bertujuan untuk mengetahui pengaruh kepemimpinan transformasionalterhadap kualitas pelayanan, budaya kerja terhadap kualitas layanan, dan untukmengetahui pengaruh kepemimpinan transformasional dan budaya kerja terhadap kualitaspelayanan. Penelitian ini menggunakan metode kuantitatif dengan menggunakan SPSS17.0 untuk mendapatkan hasil penelitian. Jumlah penduduk 242, dan sampel adalah 71.Peneliti menggunakan teknik random sampling untuk menyederhanakan jumlah populasidengan formula slovin. Hasil dari penelitian ini adalah: kepemimpinan transformasionalberpengaruh terhadap kualitas pelayanan, budaya kerja berpengaruh terhadap kualitaspelayanan, dan kepemimpinan transformasional dan budaya kerja berpengaruh terhadapkualitas pelayanan PDAM Tirta Medal Sumedang. Universitas Mercu Buana 2018-09-10 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3858 10.22441/jimb.v3i3.3858 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 3 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 349-363 2655-7274 2460-8424 10.22441/jimb.v3i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3858/2026 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/7257 2020-12-15T10:49:05Z jimb:ART driver

PENGARUH TATA KELOLA PERUSAHAAN TERHADAP PERUSAHAAN YANG MENGALAMI FINANCIAL DISTRESS Apriyanti, Ema Mujino, Mujino Rinofah, Risal Corporate Governance, Financial Distress, Altman Z-Score The purpose of this research is knowing an influence of corporate governance on companies experiencing financial distress. The indicator is used to measure corporate governance in this research are the board of director, independent commissioner, managerial ownership, and institutional ownership. While financial distress as dependent variable can be measured by Altman Z-Score. This research takes a sample in industrial sector manufacturing companies that registered on the Indonesia Stock Exchange (IDX) in 2014-2018. The sampling technique uses purposive sampling and fill the sample criteria. The sample is used in this research are 10 companies, so has obtained 50 samples researched. This research is tested by multiple regression linear analysis test. The result showes that simultaneous corporate governance variable significantly influenced on financial distress. The board of director has a significant positive influence on financial distress. Independent commissioners do not have a significant influence on financial distress. Managerial ownership and institutional ownership have a significant negative influence on financial distress. Universitas Mercu Buana 2020-07-27 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7257 10.22441/jimb.v6i2.7257 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 2 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 145 - 154 2655-7274 2460-8424 10.22441/jimb.v6i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7257/3593 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3535 2018-09-03T04:11:29Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3688 2018-09-03T03:16:59Z jimb:ART driver

ANALISIS PENGARUH BUDAYA ORGANISASI DAN KEPUASAN KERJA TERHADAP KINERJA KARYAWAN NON DOSEN PADA UNIVERSITAS MERCU BUANA JAKARTA Ikhsan, Anwar Organizaton Culture; Employee’s Satisfaction and Performance Staf The objective of this research is to analyze the effect culture organization, employee’s satisfaction to thestaff performance in Unviersity of Mercu Buana Jakarta, The Research use the approach of survey methodand then analyzed using regresion partial and simultan.Result of analysis that does in this research find that in partially has significant effect of organization culture and employee’s satisfaction to the performance staff in University of Mercu Buana Jakarta. Suchwith in simultanously also find significant effect of organization culture and employee’s satisfaction to thestaff performance in University of Mercu Buana Jakarta. Universitas Mercu Buana 2016-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3688 10.22441/jimb.v2i1.3688 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 1 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 438-456 2655-7274 2460-8424 10.22441/jimb.v2i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3688/1899 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3517 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/558 2018-08-25T04:29:54Z jimb:ART driver

ANALISA KELAYAKAN BISNIS PROYEK PEMBANGKIT LISTRIK TENAGA ANGIN (PLTB) DI INDONESIA DENGAN MENGUNAKAN SOFTWARE RETSCREEN Nashar, Muhammad Business feasibility analysis of systematic and rational is necessary before a project is needed before investment activity is realized. A tool is a software that can simplify the calculation of a project feasibility analysis is useful to simplify and make more accurate calculation can. Planned development projects Wind Power Generation (thermal power station) in Indonsia business is still something very new and still not widely practiced by investors. Indonesia has the potential of wind energy has been measured around 9.2 GW by the utilization is still very small, only about 1mW. It is thus very good potential of wind energy to be utilized. Business feasibility of simulation calculations using the software Retscreen Ambon in Maluku province, the area for projects with installed generating capacity of 330kw or a total of 5 x 1650 Kw obtained. NPV Value: USD 2,197,870 with pre-tax equity IRR of 28.8% for the IRR before tax as 14.3% for equity IRR after tax is 25.9% and for the post-tax IRR of 12.8% was also obtained assets payback period 5, 5 years. With the look of the above calculation, the electric power plant project Bayu (thermal power station) is a project that deserves to be investment Keywords: Business Feasibility Analysis, thermal power station, RetScreen Universitas Mercu Buana 2016-05-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/558 10.22441/jimb.v1i1.558 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 1 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 1-8 2655-7274 2460-8424 10.22441/jimb.v1i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/558/489 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/25842 2024-08-19T03:49:00Z jimb:ART driver

The Influence of Product Quality, Reputation, and Trust on Purchasing Decisions at PT Semarak Konstruksi Batam Andriyani, Baiq Dewi Realize, Realize Product Quality; Reputation; Trust; Purchase Decisionn Currently, the development of infrastructure such as roads, bridges and other facilities continues to increase along with population growth. This research is based on consumer complaints regarding product quality. The purpose of this study was to determine the effect of product quality, reputation and trust on purchasing decisions at PT Semarak Konstruksi Batam. The object of this research is consumers of PT Semarak Konstruksi Batam. The sampling technique used non-probability sampling. Data processed using SPSS 25. The analysis method used is descriptive statistical test, validity test and reliability test, classical assumption test, influence test and hypothesis testing. Based on the results of the study, it shows that product quality, reputation and trust partially have a positive and significant effect on purchasing decisions at PT Semarak Konstruksi Batam. Based on the anova test with the value of f count> f table and sig <0.05. It can be concluded that the variables of product quality, reputation and trust have a positive and significant influence on purchasing decisions. Universitas Mercu Buana 2024-08-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25842 10.22441/jimb.v10i2.25842 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 2 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 235-248 2655-7274 2460-8424 10.22441/jimb.v10i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25842/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/7778 2020-12-15T10:48:43Z jimb:ART driver

ANALISIS RASIO PROFITABILITAS DAN RASIO LIKUIDITAS DALAM MENGUKUR KINERJA KEUANGAN PT. GUDANG GARAM TBK PERIODE 2014-2018 Listiawati, Listiawati Kurniasari, Erni Pengukuran Kinerja Keuangan, Rasio profitabilitas dan Rasio likuiditas Kinerja keuangan merupakan salah satu alat ukur yang dapat menilai keberhasilan perusahaan dalam menghasilkan laba. Pengukuran kinerja keuangan menggunakan Rasio Profitabilitas dengan alat ukur profit margin, return on asset dan return on equity sedangkan Rasio Likuiditas diukur menggunakan current ratio dan quick ratio.Tujuan dari penelitian ini untuk mengetahui rasio profitabilitas dilihat dari Profit Margin, Return On Asset, dan Return On Equity serta rasio likuiditas dilihat dari Current Ratio dan Quick Ratio. Menganalisis kinerja keuangan yang diukur dengan rasio profitabilitas dan rasio likuiditas berdasarkan pendapat Kasmir. Jenis penelitian yang dilakukan pada penelitian ini adalah penelitian kualitatif yang didasarkan pada asumsi, pengumpulan data dan desain penelitian bersifat fleksifel atau dapat berubah. Sumber data yang diambil yaitu data sekunder dan dokumentasi dan teknik pengumpulan data dengan cara observasi, dokumen, dan triangulasi. Prosedur analisis data dengan analisis laporan keuangan PT.GUDANG GARAM TBK. Berdasarkan pendapat Kasmir. Untuk pemeriksaan keabsahan data penulis menggunak antrian gulasi dan kredibilitas.Hasil penelitian pengukuran kinerja keuangan PT. GUDANG GARAM TBK.dilihat dari rasio profitabilitas dan rasio likuditas, serta berdasarkan pendapat Kasmir periode 2014-2018 dapat dikatakan sebagai perusahaan yang kurang baik karena nilai rata-rata perhitungan kinerja keuangan selama lima tahun dibawah nilai standar ukur.Kesimpulan dari penelitian ini bahwa rasio profitabilitas dan rasio likuiditas dibawah nilai standar ukur sehingga perusahaan agar kinerja profitabilitas dapat meningkat salah satu cara yang bisa dilakukan perusahaan adalah dengan meminimalisir pengeluaran perusahaan, mengurangi beban yang tidak diperlukan, dan menunda investasi baru. Sedangkan untuk menjaga likuiditas perusahaan perlu meningkatkan arus kas. Universitas Mercu Buana 2020-04-22 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7778 10.22441/jimb.v6i1.7778 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 1 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 1 - 12 2655-7274 2460-8424 10.22441/jimb.v6i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7778/3349 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/10264 2021-04-01T16:16:40Z jimb:ART driver

Impulse Buying in Fashion Retail: Evidence at the Department Store in Daerah Istimewa Yogyakarta Sumarmi, Saptaningsih Prasyanti, Puspa Ayu shopping lifestyle, fashion involvement, store atmosphere, impulse buying behavior Abstract: This study aims to examine shopping lifestyle, fashion involvement, store atmosphere as an antecedent of impulse buying behavior. The research population has made repeat purchases at the Matahari Department Store Malioboro Mall, Yogyakarta. The sampling method uses purposive sampling, with a total sample of 115 respondents. The data analysis method uses Descriptive Analysis and Multiple Linear Regression Analysis. The results found that shopping lifestyle, fashion involvement, store atmosphere partially or simultaneously affect impulse buying behaviorKeywords: shopping lifestyle, fashion involvement, store atmosphere, impulse buying behavior Universitas Mercu Buana 2021-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10264 10.22441/jimb.v7i1.10264 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 1 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 36-48 2655-7274 2460-8424 10.22441/jimb.v7i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10264/4358 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/10264/1676 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3541 2018-08-25T05:35:19Z jimb:ART driver

PENGARUH LEVERAGE, SIZE, LIKUIDITAS, ARUS KAS OPERASI TERHADAP REVALUASI ASET TETAP Firmansyah, Dian Ahmar, Nurmala Mulyadi, Jmv Leverage; Size; Liquidity; Cash Flow from operation; Revaluations Assets; The aim of this study are to prove empirically the effect of leverage, size, liquidity andoperating cash flows of the fixed asset revaluation. The research is using sample from allnon financial companies, which doing revaluation asset during 2012-2015 throughregistered company in Indonesian Stock Exchange by upward revaluation category. Thisresearch is using Path analysis (PLS) without requiring the classical assumption test andnormality. The results showed that the leverage effect on the revaluation of fixedassets, itis proved that high leverage is reason for the company to decided doing the revaluation offixed assets, the large company is tend want to show decrease the earnings report toreduce the political cost, assets revaluation would caused recalculate value ofdepreciation to increase expense and to reduce company profits. Cash flow operationaffected the revaluation of fixed assets to company needs to be able to paid obligationsand assets revaluations required a large fund for appraisal services, audit fee and taxfinal payment. Whereas, for the liquidity is found did not effect to fixed asset revaluation,hight cost to assets revaluation and low liquidity is not reason for the company to choosethe revaluation model. In during four years of research found that the asset revaluationmodel which reported in Other comprehensive income is growing and expected to makethe financial report advantages and high quality increase through reported by fair valuein the financial report. Universitas Mercu Buana 2018-08-24 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3541 10.22441/jimb.v3i1.3541 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 1 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 1-18 2655-7274 2460-8424 10.22441/jimb.v3i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3541/1875 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/588 2018-09-03T03:15:44Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/581 2018-09-03T02:57:19Z jimb:ART driver

PENGARUH GAYA KEPEMIMPINAN DAN LINGKUNGAN KERJATERHADAP KEPUASAN KERJA KARYAWAN Fajriyah, Syarifatul Job satisfaction is important and need to be attention every organization, because human resource is the factor and the first cast in work process. Working without a satisfaction will make an employee be easy to complain, no spirit to work and difficult to get a reward. The object of this study is employee of PT. Bank Central Asia, Tbk. Cikarang Branch, Jawa Barat. This study was conducted on 60 respondents using qualitative descriptive approach. Therefore, the analysis of the data used is the statistical analysis in the form of multiple linear regression tests. The results of this study showed that partially and simultaneously, the variable of  leadership style and work environment have effect on job satisfaction the employee of PT. Bank Central Asia, Tbk. Cikarang Branch, Jawa Barat. This is evidenced from the results of simultaneous test (F test) and partial test results  (t-test) of both variant the variables of  leadership style and work environment and showed significant value and support the hypothesis. Keywords: leadership style, job environment, job satisfaction Universitas Mercu Buana 2016-05-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/581 10.22441/jimb.v1i3.581 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 3 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 413-422 2655-7274 2460-8424 10.22441/jimb.v1i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/581/509 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/31148 2025-04-15T01:35:11Z jimb:ART driver

Enhancing Customer Experience: Analyzing Rocket Indonesia Application Satisfaction Using SERVQUAL and IPA Usiawan, Daniel Wibowo Vikaliana, Resista Customer Satisfaction; Service Quality (SERVQUAL); Importance Performance Analysis (IPA); Service Improvement This study aims to analyze the level of customer satisfaction for the Roket Indonesia application. Using the Service Quality (SERVQUAL) and Importance Performance Analysis (IPA) methods, this study measures service quality and identifies priority areas for improvement. Data was collected from 133 application users, with a sample of 100 people, and analyzed using SPSS. The results show that all 12 items tested meet the criteria for validity and reliability. The GAP analysis shows that four out of 12 attributes perform beyond expectations, while the other eight attributes need to be improved. However, the overall customer satisfaction level reached 77.78%, indicating that in general, customers are satisfied with the service provided. Based on the analysis, several areas that need to be improved are consistency in delivery, ability to resolve delivery issues, and guarantee of replacement goods if goods are damaged or lost during delivery. Improvement proposals include conducting regular audits, enhancing delivery staff training, forming a special team for resolving delivery issues, implementing an efficient and responsive complaint management system, and providing a clear and transparent goods replacement policy. This research provides valuable insights for PT. TIKI Jalur Nugraha Ekakurir Tomang in their efforts to continuously meet and exceed customer expectations. Furthermore, the results of this study can be used as a basis for improving services and business strategies in the future. Universitas Mercu Buana 2025-04-10 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/31148 10.22441/jimb.v11i1.31148 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 1 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 1-17 2655-7274 2460-8424 10.22441/jimb.v11i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/31148/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3505 2018-08-24T07:02:51Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/25325 2024-03-31T13:25:30Z jimb:ART driver

Workload, Motivation, and Satisfaction's Impact on Employee Performance in Karimun's Savings and Loan Cooperative Aran, Klementina Kona Suhardi, Suhardi Employee Performance; Job Satisfaction; Savings and Loan Cooperatives; Workload; Work Motivation This qualitative research focuses on employees of savings and loan cooperatives in Karimun and Batam, comprising two Savings and Loan Cooperatives (KSP) in Karimun and five KSPs in Batam, including KSP CU Jembatan Kasih, KSP Golden Madani Sejahtera, KSP Tuah Madani Sejahtera, and KSP Pioneer Golden Raya. The study involves 100 respondents selected through purposive sampling, employing a survey method with questionnaires distributed directly to respondents. The Likert scale (1 to 5) serves as the measurement scale, and data analysis utilizes multiple linear regression with the SPSS program. The results support Hypotheses H1, H2, and H3, confirming the positive impacts of workload, work motivation, and job satisfaction on employee performance in Savings and Loan Cooperatives in Karimun. However, Hypothesis H4, proposing simultaneous influences from workload, motivation, and satisfaction, is only partially supported, with workload and work motivation exhibiting significant impacts while job satisfaction does not demonstrate a statistically significant role. These findings enhance our understanding of factors influencing employee performance in Savings and Loan Cooperatives in Karimun. Universitas Mercu Buana 2024-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25325 10.22441/jimb.v10i1.25325 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 1 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 119-126 2655-7274 2460-8424 10.22441/jimb.v10i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25325/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6940 2020-07-27T02:42:04Z jimb:ART driver

ANALISIS PENGARUH LEVERAGE, LIKUIDITAS, TAX AVOIDANCE DAN UKURAN PERUSAHAAN TERHADAP NILAI PERUSAHAAN (Studi Empiris Pada Perusahaan Manufaktur Sektor Industri Barang Konsumsi yang Terdaftar di Bursa Efek Indonesia Tahun 2014-2017) Hani, Fathihani Leverage, Likuiditas, Penghindaran Pajak, Ukuran Perusahaan, Nilai Perusahaan. Penelitian ini dilakukan untuk menganalisis dampak leverage, likuiditas, penghindaran pajak, dan ukuran perusahaan terhadap nilai perusahaan. Variabel independen diwakili oleh leverage, likuiditas, penghindaran pajak dan ukuran perusahaan.Rasio hutang terhadap ekuitas digunakan untuk mengukur leverage.Rasio lancar digunakan untuk mengukur likuiditas.Tarif pajak efektif digunakan untuk mengukur penghindaran pajak.Terakhir, ukuran perusahaan diukur dengan total aset.Populasi penelitian ini adalah sektor barang dan konsumsi perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia (BEI) untuk periode 2014-2017.Total pengamatan 13 ditentukan dengan purposive sampling.Harga ke nilai buku digunakan untuk mengukur nilai perusahaan.Penelitian ini menggunakan analisis regresi berganda.Hasil menunjukkan bahwa penghindaran pajak tidak mempengaruhi nilai perusahaan.Kemudian leverage, likuiditas, dan ukuran perusahaan memiliki pengaruh signifikan terhadap nilai perusahaan. Implikasi dari penelitian ini menunjukkan bahwa leverage dapat mendorong perusahaan untuk mengambil tindakan agresif untuk mendapatkan margin optimal, likuiditas menunjukkan bagaimana perusahaan menggunakan likuiditas untuk memenuhi kewajiban jangka pendeknya, dan ukuran perusahaan sebagai variabel penting untuk menunjukkan total aset untuk nilai perusahaan. Sedangkan penghindaran pajak tidak mempengaruhi nilai perusahaan. Universitas Mercu Buana 2019-12-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6940 10.22441/jimb.v5i3.6940 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 3 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 166-179 2655-7274 2460-8424 10.22441/jimb.v5i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6940/2984 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/13762 2022-10-07T09:28:10Z jimb:ART driver

The Influence of Brand Image and Product Price towards Purchase Decision at E-commerce Tokopedia Prasetio, Adhi Angelina, Adevia Puji Brand Image, Product Price, Purchase Decision, E-Commerce, Tokopedia Internet growth in Indonesia has rapidly affected economic stability. Buying and selling transaction becoming more efficient and could be done without face to face through online platform such as e-commerce as the effect of internet development. Tokopedia is one of the successful e-commerce which was ranked in the first position of the highest transaction in Indonesia, therefore this research for a benchmark is needed. The purpose of this study was to determine partially the influence of brand image and product price towards purchase decision and the influence of simultaneous brand image and product price towards purchase decision. This research was conducted on e-commerce Tokopedia users with sample around 400 taken using purposive sampling. Data was collected using online questionnaire with multiple linear regression technique analysis. Data was proceed using SPSS 25 for Mac. The result show brand image and product price have a partially significant effect towards on Tokopedia e-commerce purchase decision, brand image and product price have a simultaneous significant effect towards on Tokopedia e-commerce purchase decision. Universitas Mercu Buana 2022-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13762 10.22441/jimb.v8i1.13762 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 1 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 79-95 2655-7274 2460-8424 10.22441/jimb.v8i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13762/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/13762/2614 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/13762/2615 Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/16299 2023-11-30T15:11:24Z jimb:ART driver

The Effect of Executive Compensation, Executive Characteristics, An Executive Shareholding on Tax Avoidance Qotrunnada, Nabila Hwa, Tjoa Han Mayasari, Dwi This study aims to empirically prove the effect of executive compensation, executive characteristics, and executive share ownership on tax evading. This study was showed in the consumer goods manufacturing corporation listed on the Indonesia Stock Exchange (IDX) from 2016–2020, using a descriptive associative research method and secondary data. The sampling method used purposive.  This research used 16 sample corporations, with a five-year research period of 5 years, so 80 samples were obtained for data processing using Microsoft Excel and the e-View Statistical software applications to analyze descriptive statistics, model conformity tests, classical assumption tests, coefficients of determination (R2), linear regression analysis of panel data, statistical test F and statistical test t. Results of statistical test F executive-compensation variables, executive-characteristics, and decision-making-shareholdings affect tax avoidance. The statistical test t of the executive compensation variable partially has a optimistic and significant effect on dividend payments—however, the executive's variable characteristics and the executive shares' ownership harm tax evading. Universitas Mercu Buana 2023-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/16299 10.22441/jimb.v9i1.16299 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 1 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 84-100 2655-7274 2460-8424 10.22441/jimb.v9i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/16299/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/36480 2026-04-04T08:45:13Z jimb:ART driver

MOTIVATION, DISCIPLINE, AND EMPLOYEE PERFORMANCE IN THE SOUTH TANGERANG FIRE AND RESCUE SERVICE Anggraeni, Priska Widya Work Motivation, Work Discipline, Employee Performance. This study aims to analyze the effect of motivation and work discipline on employee performance at the South Tangerang City Fire Department. The validity and reliability tests indicated that all indicators of motivation (X1), work discipline (X2), and performance (Y) were valid and reliable. The partial test (t-test) showed that motivation (tcount = 2.887; sig. 0.008) and work discipline (tcount = 2.160; sig. 0.000) have a positive and significant effect on performance. The coefficient of determination revealed that motivation explains 58.2% of performance variation, while work discipline explains 53.4%. Simultaneously, the F-test (Fcount = 24.374; sig. 0.000) confirmed that motivation and work discipline together significantly influence performance, with a contribution of 64.4%. Therefore, motivation and work discipline are proven to have a positive, strong, and significant effecton employee performance. Universitas Mercu Buana 2026-04-04 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/36480 10.22441/jimb.v12i1.36480 Jurnal Ilmiah Manajemen dan Bisnis; Vol 12, No 1 (2026): Jurnal Ilmiah Manajemen dan Bisnis; 121-137 2655-7274 2460-8424 10.22441/jimb.v12i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/36480/pdf Copyright (c) 2026 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/4402 2018-11-19T07:10:55Z jimb:ART driver

PENGARUH BUDAYA ORGANISASI DAN KOMITMEN ORGANISASI TERHADAP PENGEMBANGAN KARIR PADA KARYAWAN PENDUKUNG AKADEMIK PERGURUAN TINGGI SWASTA X Herlin, Herlin Organizational Culture; Organizational Commitment; Career Development; This study aims to explain the influence of organizational culture and organizationalcommitment to career development. This study uses descriptive analysis research model andmultiple linear analysis. Data is collected by distributing questionnaires to 113 employeesworking in Private Higher Education X and research is based on cases that are happening inPrivate Higher Education X. The results of multiple linear regression analysis showed thatsimultaneously and partially the Organizational Culture variable had no effect on the CareerMining. However, Organizational Commitment has an influence on Career DevelopmentEmployee Supporting Academic. (1) there is no partial influence between the OrganizationalCulture on Career Development (2) partially there is a positive and significant influencebetween organizational commitment to career development. Universitas Mercu Buana 2018-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4402 10.22441/jimb.v4i1.4402 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 1 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 101-112 2655-7274 2460-8424 10.22441/jimb.v4i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4402/2170 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/570 2018-09-03T02:57:19Z jimb:ART driver

JURNAL PENGARUH PERSEPSI HARGA DAN PROMOSI TERHADAP KEPUTUSAN PEMBELIAN KONSUMEN PRODUK ENERVON-C Samosir, Charlie Bernando Halomoan Prayoga, Arief Bowo Level of competition companies that sell adult multivitamin product is getting tougher due to the increasing demand of multi-vitamins, especially vitamin C. People are faced with a wide selection of products, so that the perception of price and promotional activities are carried into consideration in product purchasing decisions. This study aimed to test whether the effect of the perception of price and product promotion Enervon-C on product purchasing decisions. This study was conducted on 100 people Enervon-C product buyers in supermarkets Tip Top Ciputat,Tangerang Banten with convinance sampling method. The empirical test results indicate that the perception of price and promotion has a positive and significant influence on purchasing decisions product of Enervon-C, nevertheless contributes only 50.2% to the purchasing decision.Keywords: Perception Price, Promotion, Consumer Purchasing Decision, Product Enervon-C. Universitas Mercu Buana 2016-05-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/570 10.22441/jimb.v1i3.570 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 3 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 207-279 2655-7274 2460-8424 10.22441/jimb.v1i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/570/501 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/31699 2025-04-15T07:21:16Z jimb:ART driver

Transportation Cost Analysis Using Activity-based Costing in Waste Collection Distribution of ESWKA Waste Bank in Cilegon Iskandar, Yelita Anggiane Vikaliana, Resista Khairunnisa, Nazihah Muhyi, Lana Salsabila Pratama, Fikih Urdi Passasung, Octaviano Rosario Oktafiani, Intan ABC Method; Transportation Cost; Waste Distribution In this study, the main problem encountered is the calculation to determine the actual operating costs in knowing the profit or deficit experienced by Bank Sampah Eswka is still not available. The ABC method is used to identify costs based on transportation operational activities for waste collection from Bank Sampah Unit (BSU) towards Bank Sampah Induk (BSI). The results showed significant efficiency in the calculation of operational costs with a difference in internal costs with a contract value in the range of IDR 993 to IDR 8,220. Thus, the use of the ABC method helps Bank Sampah Eswka to recognize the achievement of a high level of operational efficiency, which allows them to manage waste distribution and processing at a lower cost compared to contractors. This shows that the existing internal system is effective and efficient. Universitas Mercu Buana 2025-04-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/31699 10.22441/jimb.v11i1.31699 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 1 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 18-27 2655-7274 2460-8424 10.22441/jimb.v11i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/31699/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/21710 2023-12-07T03:09:20Z jimb:ART driver

Influence of Brand Awareness, Brand Image, and Trust Against Kopi Kenangan Purchasing Decisions in West Jakarta Islahiyah, Nurul Utama, Andyan Pradipta Brand Awareness; Brand Image; Trust; Purchase Decision This research aims to investigate the impact of brand recognition, brand image, and trust on purchase decisions for Kopi Kenangan, a popular coffee brand in West Jakarta. The study used purposive sampling to select 150 respondents from the Kopi Kenangan customer community, and data was collected through a survey questionnaire. The Partial Least Squares (PLS) technique was used to analyze the data. The study found that brand awareness, brand image, and trust have a significant and positive effect on customers' purchase decisions. The results of this study provide valuable insights into the factors that influence customer loyalty and purchase behavior in the coffee industry.   Universitas Mercu Buana 2023-12-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/21710 10.22441/jimb.v9i3.21710 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 3 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 341-354 2655-7274 2460-8424 10.22441/jimb.v9i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/21710/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6834 2019-09-05T10:07:57Z jimb:ART driver

PENGARUH STORE ATMOSPHERE, DISPLAY PRODUK DAN PROMOSI TERHADAP PEMBELIAN IMPULSIF DI MIROTA KAMPUS YOGYAKARTA Ningsih, Juwarti Store Atmosphere, Display Produk, Promosi dan Pembelian Impulsif. Penelitian ini bertujuan untuk mengetahui pengaruh store atmosphere,display produk dan promosi terhadap pembelian Impulsif di Mirota Kampus Yogyakarta (kajian pada mahasiswa Universitas Mercu Buana Yogyakarta). Penelitian ini merupakan penelitian survei dengan menggunakan kuesioner sebagai instrumennya. Populasi yang digunakan dalam penelitian ini adalah mahasiswa Universitas Mercu Buana Yogyakarta yang pernah bertransaksi di Mirota Kampus Yogyakarta. Sampel yang diambil sebanyak 90 responden.Hasil dari penelitian ini adalah (1) store atmosphere secara parsial tidak berpengaruh terhadap pembelian impulsif. Hal ini ditunjukkan dengan nilai sigifikansi (P) >0,05 yaitu 0,888 >0,05 atau nilai t hitung - 0,142 < t tabel 1, 96793. (2) display produk secara parsial tidak berpengaruh terhadap pembelian impulsif. Hal ini ditunjukkan dengan nilai signifikansi (P) >0,05 yaitu sebesar 0,112>0,05 atau t hitung 0,172<1,96793. (3) promosi secara parsial berpengaruh terhadap pembelian impulsif. Hal ini ditunjukkan dengan nilai signifikansi (P) <0,05 yaitu sebesar 0,026<0,05 atau t hitung 2,261>1,96793.(4) store atmosphere, display produk, dan promosi secara simultan (bersama-sama) terhadap pembelian impulsif. Hal ini ditunjukkan nilai signifikasi untuk pengaruh store atmosphere, display produk, dan promosi terhadap pembelian impulsif secara simultan terhadap pembelian impulsif <0,05 yaitu sebesar 0,021 <0,05 atau nilai F hitung 3,403 > F tabel 2,71. (5) Nilai koefisien beta tersebut <0,05 yaitu sebesar 0,247<0,05 atau Universitas Mercu Buana 2019-09-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6834 10.22441/jimb.v5i2.6834 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 2 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 190 - 203 2655-7274 2460-8424 10.22441/jimb.v5i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6834/2874 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/12182 2021-11-30T15:43:04Z jimb:ART driver

Performance Assessment Of PT. Indofood Sukses Makmur CBP Tbk 2018-2020 Based On Value Creation For Financial Strategy And Investment Decisions Ardyanfitri, Helmina Pertiwi, Eka Mega The Covid-19 condition brought changes to the company's performance and this situation was also felt by PT. Indofood Sukses Makmur CBP, Tbk. Thus, performance appraisal is needed by companies to evaluate and decide policies and take the right strategy. Performance appraisal for public companies can encourage value creation into stable growth, so that companies have good performance both from operations and finance and the public can invest in these companies. The purpose of this study is to assess the company's internal performance in order to assist the company in determining strategies that are appropriate to the company's circumstances and assessing the company's external performance for investment decision making for investors. This research method is a qualitative research with postpositivism method. The results of this study indicate that PT. Indofood Sukses Makmur CBP Tbk in 2018-2020 is in quadrant II in the financial strategy matrix by having a positive value in MVA and being in the excellent value manager quadrant in GVM, so that PT. Indofood Sukses Makmur CBP Tbk is very suitable for long term investment. Universitas Mercu Buana 2021-11-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12182 10.22441/jimb.v7i3.12182 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 3 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 348-361 2655-7274 2460-8424 10.22441/jimb.v7i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12182/4946 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/12182/2179 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/36867 2025-12-04T03:24:26Z jimb:ART driver

Antecedents of Job Satisfaction to Moonlighting Intentions Mediated by Organizational Commitment of Private Companies in Jakarta Afandi, Irawan Nilasari, B. Medina Berliyanti, Dita Oki Moonlighting Intention; Personal Reasons; Organizational Commitment; Job Satisfaction; Employee Behavior; Private Sector; Mediation This research aims to examine the influence of Moonlighting Intention and Personal Reasons on Job Satisfaction and Organizational Commitment, with a particular focus on the mediating role of Organizational Commitment. The study was conducted among employees working in private companies located in Jakarta, Indonesia. A total of 184 respondents participated, representing diverse educational backgrounds, working experiences, and demographic characteristics. The research applied a quantitative approach with data collected through a structured online questionnaire distributed via Google Forms, utilizing a cross-sectional survey design. Data were analyzed using descriptive statistics and hypothesis testing. The results indicate that Moonlighting Intention has a positive and significant impact on both Job Satisfaction and Organizational Commitment. However, Personal Reasons do not significantly influence Organizational Commitment or Job Satisfaction. Furthermore, Organizational Commitment shows a positive and significant effect on Job Satisfaction, but it does not function as a mediating variable between Moonlighting Intention or Personal Reasons and Job Satisfaction.These findings suggest that employees' intention to engage in additional jobs outside their primary employment does not necessarily reduce their organizational commitment or satisfaction levels. Conversely, personal motivations alone are insufficient to enhance employees’ commitment or satisfaction without organizational support. The study highlights the importance of strengthening organizational policies that foster employee engagement, loyalty, and satisfaction, particularly in the context of balancing external work activities and organizational responsibilities. The results contribute to the growing body of research on employee behavior in the private sector, providing valuable insights for organizational management to develop more effective human resource strategies Universitas Mercu Buana 2025-12-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/36867 10.22441/jimb.v11i3.36867 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 3 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 380-398 2655-7274 2460-8424 10.22441/jimb.v11i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/36867/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/36867/9339 Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3848 2018-09-10T02:38:32Z jimb:ART driver

PENGARUH MOTIVASI DAN KOHESIVITAS KELOMPOK TERHADAP KINERJA PENDAMPING PROGRAM KELUARGA HARAPAN (PKH) DI KOTA BEKASI Purba, Charles Bohlen Primayoga, Kukuh Motivasi; Kohesivitas Kelompok; Kinerja Pendamping PKH; Penelitian ini bertujuan untuk mengetahui dan menganalisa seberapa besar pengaruh motivasi dan kohesivitas kelompok terhadap kinerja pendamping Program Keluarga Harapan (PKH) di Kota Bekasi. Jenis penelitian ini adalah deskriptif kuantitatif.Penentuan sampel menggunakan rumus Slovin sebanyak 100 responden. Metode pengumpulan data yang digunakan adalah dengan memberikan instrument penelitian berupa kuesioner kepada responden. Pengolahan data menggunakan analisis regresi dengan bantuan SPSS 16.0. Hasil penelitian ini menunjukan bahwa motivasi yang terdiri dari motivasi instrinsik dan motivasi ekstrinsik memberi pengaruh positif terhadap kinerja, sedangkan kohesivitas kelompok yang terdiri dari forming, norming, performing dan storming memberi pengaruh positif terhadap kinerja. Hasil uji t variable motivasi berpengaruh signifikan terhadap kinerja, karena Berdasarkan hasil analisis dan temuan dalam penelitian ini maka dapat disimpulkan bahwa variable motivasi dan kohesivitas kelompok mempunyai pengaruh yang signifikan terhadap kinerja t hitung = 3.812, lebih besar dari t table signifikan 0.05 (t-tabel = 1.661). sedangkan variable kohesivitas kelompok juga berpengaruh signifikan terhadap kinerja, karena t hitung = 4.016 lebih besar dari t table signifikan 0.05 (t-tabel = 1.661). Berdasarkan hasil analisis dan temuan dalam penelitian ini maka dapat disimpulkan bahwa variable motivasi dan kohesivitas kelompok mempunyai pengaruh yang signifikan terhadap kinerja pendamping PKH di Kota Bekasi. Universitas Mercu Buana 2018-09-10 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3848 10.22441/jimb.v3i2.3848 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 2 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 189-204 2655-7274 2460-8424 10.22441/jimb.v3i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3848/2016 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/4091 2019-07-05T15:33:14Z jimb:ART driver

PENINGKATAN DISIPLIN PEGAWAI YANG DIPENGARUHI OLEH MOTIVASI DAN VISI YANG DIKOMUNIKASIKAN DENGAN BAIKPENINGKATAN DISIPLIN PEGAWAI YANG DIPENGARUHI OLEH MOTIVASI DAN VISI YANG DIKOMUNIKASIKAN DENGAN BAIK Pratama, Aditya perbankan; disiplin; motivasi; komunikasi visi; pegawai Perbankan adalah salah satu industri jasa yang bergerak di bidang keuangan. Salah satu tujuan khususnya adalah menjangkau nasabah sebanyak dan seluas mungkin. Dalam rangka merealisasi hal tersebut, maka perbankan pada umumnya memiliki karyawan dengan berbagai posisi leader dan non leader pada cabang yang tersebar. Disiplin adalah salah satu syarat utama dalam membangun ritme kerja yang baik yang nantinya juga akan berujung kepada pencapaian target baik secara khusus maupun umum. Menunjuk hal tersebut di atas maka penelitian ini dilakukan agar dapat memberikan gambaran yang nyata akan hubungan motivasi serta komunikasi visi yang baik akan memberikan pengaruh kepada disiplin karyawan tersebut. Universitas Mercu Buana 2018-11-14 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4091 10.22441/jimb.v4i2.4091 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 2 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 215-223 2655-7274 2460-8424 10.22441/jimb.v4i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4091/2242 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/9866 2020-12-15T10:40:37Z jimb:ART driver

ANALISIS TRANSFORMASI DIGITALISASI MELALUI APLIKASI SISTEM INTEGRASI KONSTRUKSI TERHADAP PRODUKTIVITAS KERJA QUANTITY SURVEYOR PROYEK KONSTRUKSI BANGUNAN GEDUNG Putri, Caesarani Gloria Santoso, Sugeng digitization; productivity; re-engineering business processes; quantity surveyor; construction In this study, the authors transformed the digitalization by using a construction integration system application in one of the building construction projects built by PT. X with the aim of compiling an analysis of system application digitalization transformation. Construction integration through re-engineering business processes to increase productivity so as to speed up the work time of surveyors and also to assess the impact of implementing the construction integration system on the quantity of surveyors. The results show that with the transformation of digitizing the use of the construction integration system application, procurement process becomes a more effective and efficient process in increasing productivity because it can reduce processes that are not needed in a procurement process. The impact of implementing this transformation is in the grouping of budgets / costs according to the scope of work and location, starting from making work orders and progressing the work, shortening the work progress transaction flow, and in controlling the work area that has been done. PT. X carried out the transformation by creating a construction integration system digitization program used in building construction projects. This transformation is implemented in all PT. X with the aim of increasing employee productivity in order to avoid project implementation time. Universitas Mercu Buana 2020-12-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/9866 10.22441/jimb.v6i3.9866 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 3 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 335 - 346 2655-7274 2460-8424 10.22441/jimb.v6i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/9866/3997 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/1762 2017-09-28T00:55:40Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3711 2018-09-03T06:58:47Z jimb:ART

PENGARUH DISIPLIN DAN MOTIVASI KERJA TERHADAP PRODUKTIVITAS KERJA KARYAWAN STUDI KASUS DI PT. CONSULTING SERVICES INDONESIA Parashakti, Ryani Dhyan Nashar, Muhammad Penelitian ini bertujuan untuk menganalisis : (1) disiplin kerja di PT. Consulting Services Indonesia; (2)motivasi karyawan PT. Consulting Services Indonesia; (3) produktivitas kerja karyawan PT. ConsultingServices Indonesia; (4) pengaruh signifikan antara disiplin kerja terhadap produktivitas kerja karyawan PT.Consulting Services Indonesia; (5) pengaruh signifikan antara motivasi karyawan terhadap produktivitaskerja karyawan PT. Consulting Services Indonesia. Metode penelitian menggunakan metode kuantitatifdeskriptif dengan teknik pengumpulan data menggunakan data primer. Populasi penelitian ini adalahkaryawan divisi finance and accounting PT. Consulting Services Indonesia dengan sampe sebanyak 60orang. Teknik analisis data menggunakan metode analisis linear, uji hipotesis menggunakan uji t, dan R.Adapun hasil penelitian tersebut menunjukkan bahwa terdapat pengaruh secara signifikan antara disiplinkerja terhadap produktivitas kerja sedangkan untuk variabel motivasi tidak signifikan terhadapproduktivitaskerjakaryawanpadadivisifinanceandaccountingPT.ConsultingServicesIndonesia. Universitas Mercu Buana 2018-08-24 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3711 10.22441/jimb.v2i2.3711 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 2 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 695-714 2655-7274 2460-8424 10.22441/jimb.v2i2 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/28119 2024-12-11T05:46:59Z jimb:ART driver

The Influence of Brand Image, Price Perception, Brand Awareness on Brand Loyalty (Study on Wardah Facial Cleanser Customers) Puspasari, Fitri Diana Utama, Andyan Pradipta Brand Image; Price Perception; Brand Awareness; Brand Loyalty The research aims to determine the effect of brand image, price perception, brand awareness on brand loyalty (study on wardah facial cleanser customers). This research was conducted on 185 respondents using a quantitative approach. The data analysis method used is Structural Equation Modelling (SEM). The results showed that brand image has a positive and significant effect on wardah facial cleanser brand loyalty, price perception has a positive and significant effect on wardah facial cleanser brand loyalty, brand awareness has a positive and significant effect on wardah facial cleanser brand loyalty. Universitas Mercu Buana Universitas Mercu Buana 2024-12-04 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/28119 10.22441/jimb.v10i3.28119 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 3 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 316-326 2655-7274 2460-8424 10.22441/jimb.v10i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/28119/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/7208 2020-12-15T10:48:43Z jimb:ART driver

Pengaruh Kepemilikan Manajerial, Kepemilikan Institusional, Arus Kas Bebas, dan Leverage Terhadap Kebijakan Dividen Firdaus, Shintya Nurhanifah Mujino, Mujino Rinofah, Risal managerial ownership, institutional ownership, free cash flow, leverage, dividend policy The study aims at testing thee effect managerial ownership, institutional ownership, free cash flow, and leverage on dividend policy of manufacturing companies in other industry sector and consumer goods industry sector on the Indonesia Stock Exchange. The study collected from annual report the Indonesia Stock Exchange consisting of 13 companies. The data were collected from annual report from five consecutive years (2014 – 2018). The finding indicates that the variable that have a significant effect on dividend policy are free cash flow and leverage. While the variable of managerial ownership and institutional ownership do not significantly affect dividend policy. Universitas Mercu Buana 2020-04-22 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7208 10.22441/jimb.v6i1.7208 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 1 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 77 - 85 2655-7274 2460-8424 10.22441/jimb.v6i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7208/3356 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/237 2016-05-01T23:16:45Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/14685 2022-08-02T07:18:30Z jimb:ART driver

Concept and Prototype Design Differentiation Strategy Application (Case Study on Restaurants at Medan Plaza Fair, Medan City) Harahap, Kartini Concept design; prototype; design thinkin; differentiation strategy The study aims to design application concepts and prototypes of differentiation strategies in achieving competitive advantage in restaurants using a design thinking model (a case study on a restaurant at Medan Plaza Fair Medan City), related to the problem of restaurants that must be able to deal with the COVID-19 pandemic situation amid of a highly competitive environment. The study used a descriptive qualitative approach and used purposive random sampling for sampling. The type of data used is primary and secondary data with data collection through interviews, observation and documentation. Data analysis uses value chain analysis, and design thinking models. The results showed that the conceptual design in building the application of a differentiation strategy to achieve competitive advantage in restaurants consisted of four data pillars, namely (i)identification, (ii) analysis of potential sources of differentiation, (iii)creating differentiation, and (iv)restaurant value chains.The prototype built on the application of a restaurant's differentiation strategy consists of five differentiations, namely: (i)product differentiation, (ii)service differentiation, (iii)place differentiation, (iv)personnel differentiation, and (v)channel differentiation.This research is expected to be able to build an application of competitive strategy through an effective differentiation strategy, making it easier for restaurant business people to develop and define differentiation strategies in achieving competitive advantage and provide opportunities for restaurant businesses to always innovate in strategies that are adaptive to any changes in the dynamic and complex environment. Universitas Mercu Buana 2022-08-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14685 10.22441/jimb.v8i2.14685 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 2 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 264-276 2655-7274 2460-8424 10.22441/jimb.v8i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14685/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/20836 2023-12-02T02:57:17Z jimb:ART driver

How Do Start-up Characteristics and Innovation Practices Influence Share Value? An Empirical Examination Situmorang, Anjhu Richer Natal Ebenezer Fahlevi, Mochammad Ariesa, Yeni Start-up; Share value; Asset; Capital; Employees Start-up ecosystems, with their inherent dynamism and potential for innovation, have grown significantly in recent years. However, understanding the factors that influence their share value remains an intricate task. This research aims to elucidate the direct and indirect impacts of start-up attributes - assets, capital, and employees - and their innovative practices on the share value of these burgeoning enterprises. Using regression analysis on data collected from start-ups operating between 2019 and 2022, this study uncovers several critical insights. The assets, capital, and number of employees were found to have a significant influence on the level of innovation within the start-up. Yet, surprisingly, these factors, along with innovation itself, did not exert a direct influence on the start-up shares. However, an indirect effect was noticed, with assets and capital influencing shares when mediated by innovation. No such indirect effect was discerned with the number of employees. This study enriches the existing literature by providing a nuanced perspective on the interconnectedness of start-up characteristics, innovation, and share value. Moreover, it presents vital insights to investors and start-up decision-makers by underscoring the essential role of innovation in enhancing share value. For future research, exploration of other potential mediators and examination of these relationships across diverse start-up contexts is recommended to develop a more comprehensive understanding. Universitas Mercu Buana 2023-08-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/20836 10.22441/jimb.v9i2.20836 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 2 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 281-291 2655-7274 2460-8424 10.22441/jimb.v9i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/20836/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5619 2019-05-07T05:59:51Z jimb:ART driver

PENGARUH GAYA KEPEMIMPINAN TRANSFORMASIONAL, MOTIVASI KERJA DAN KEDISIPLINAN TERHADAP KINERJA KARYAWAN Paijan, Paijan Bernadetha, Suzan Widayati, Catur Anggi, Anggi W. Tujuan penelitian ini adalah untuk mengetahui dan menganalisis pengaruh gaya kepemimpinan transformasional, motivasi kerja dan kedisiplinan terhadap kinerja karyawan. Penelitian ini merupakan jenis penelitian asosiatif kausal yang bertujuan untuk menganalisis hubungan antara satu variabel dengan variabel lainnya atau bagaimana suatu variabel mempengaruhi variabel lain. Populasi dalam penelitian ini adalah karyawan yang bekerja pada Koperasi Berkah Makmur. Metode pengambilan sampel menggunakan teknik sampling jenuh dengan jumlah sampel sebanyak 32 responden. Data primer dikumpulkan melalui penyebaran kuesioner, data sekunder dikumpulkan melalui studi pustaka. Metode analisis data yang digunakan adalah metode analisis deskriptif dan kuantitatif dengan teknik analisis regresi linier berganda. Hasil pengujian hipotesis penelitian menunjukkan bahwa variabel gaya kepemimpinan transformasional dan motivasi kerja tidak berpengaruh terhadap kinerja karyawan, namun kedisiplinan berpengaruh terhadap kinerja karyawan. Uji Koefisien Determinasi menunjukkan bahwa 62,4% kinerja karyawan dapat dijelaskan oleh variabel gaya kepemimpinan transformasional, motivasi kerja, dan kedisiplinan, sedangkan sisanya sebesar 37,6% dijelaskan oleh faktor-faktor lain yang tidak diikutsertakan dalam penelitian ini. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5619 10.22441/jimb.v4i3.5619 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 3 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 429 - 443 2655-7274 2460-8424 10.22441/jimb.v4i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5619/2559 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/11742 2021-07-30T16:25:49Z jimb:ART driver

THE EFFECT OF TOTAL ASSETS TURNOVER, CURRENT RATIO AND FINANCIAL TECHNOLOGY ON THE PROFITABILITY OF BANKING COMPANIES IN INDONESIA Prasetio, Angga Eko Al Azizah, Ummu Salma Daulay, Yusdi Penelitian ini menjelaskan pengaruh dari total assets turnover, current ratio dan financial technology terhadap Profitabilitas bank umum konvensional di Indonesia periode triwulan satu sampai empat di 2017-2019 dan triwulan satu sampai tiga di 2020. Variabel bebas menggunakan variabel total assets turnover, current ratio dan financial technology. Variabel terikat menggunakan Profitabilitas bank dengan pengukuran Return On Assets (ROA). Populasi yang digunakan sejumlah 44 bank konvensional dan sample berjumlah 4 bank yang terdaftar di Bursa Efek Indonesia (BEI). Teknik analisis linear berganda dengan menggunakan eviews 11 untuk mengelola dan menganalisis yang berkaitan dengan analisis kuantitatif guna mengetahui hubungan antar variabel. Hasil uji parsial (Uji T) menunjukan bahwa variabel Total Assets Turnover tidak berpengaruh dan tidak signifikan positif terhadap Profitabilitas, untuk variabel Current Ratio berpengaruh positif dan signifikan terhadap Profitabilitas dan variabel Financial Technology berpengaruh negative dan signifikan terhadap Profitabilitas perbankan. Hasil uji simultan (Uji F) menghasilkan bahwa variabel Total Assets Turnover, Current Ratio dan Financial Technology berpengaruh terhadap Profitabilitas perbankan Universitas Mercu Buana Universitas Muhammadiyah Prof Dr Hamka 2021-07-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11742 10.22441/jimb.v7i2.11742 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 2 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 253-262 2655-7274 2460-8424 10.22441/jimb.v7i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11742/4654 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/34218 2025-08-20T14:33:36Z jimb:ART driver

Efektivitas Metode Pembelajaran Daring terhadap Peningkatan Kinerja dan Kompetensi ASN, Studi Kasus di RSUP Dr. Sitanala Tangerang Hastuti, Ade Dewi Tamyiz, Fauzul Abdurrahman Puspaningrum, Florentina Endah Online Learning; ASN Performance; Competence; Regulation; Knowledge Management This study aims to analyze the effectiveness of online learning methods in improving the performance and competence of Civil Servants (ASN), using a case study at RSUP Dr. Sitanala Tangerang, with a focus on regulatory frameworks and learning theories. The research method used is literature study by collecting and analyzing data on online learning practices at RSUP Dr. Sitanala and from laws and regulations, policy documents, and expert theories related to online learning and knowledge management. The results show that online learning has great potential to improve ASN competence, especially in terms of time efficiency and accessibility. However, its effectiveness depends heavily on motivational support from management, technological support, and ongoing evaluation. Regulatory frameworks such as Government Regulation No. 17 of 2020 and Minister of Health Regulation No. 20 of 2014 emphasize the importance of developing ASN competence through modern methods, including online learning. Universitas Mercu Buana 2025-08-20 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/34218 10.22441/jimb.v11i2.34218 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 2 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 245-253 2655-7274 2460-8424 10.22441/jimb.v11i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/34218/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/34218/8539 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/34218/8791 Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3831 2018-09-08T01:13:48Z jimb:ART driver

PENGHARGAAN SERTA PENGARUHNYA TERHADAP KINERJA KARYAWAN (Studi Kasus pada PT. PLN (Persero) Distribusi Jakarta Raya dan Tangerang) Purba, Chi Chi Sintia Wahyono, Tri aktualisasi diri; penghargaan; kinerja; Structural Equation Model (SEM); Partial Least Square (PLS); Penelitian bertujuan untuk menguji dan menganalisis Pemenuhan Kebutuhan Aktualisasi Diri danPenghargaan serta Pengaruhnya terhadap Kinerja Karyawan. Objek pada penelitian ini adalah karyawan PT.PLN (Persero) Distribusi Jakarta Raya dan Tangerang. Penelitian ini dilakukan terhadap 74 responden.Pendekatan yang digunakan dalam penelitian ini adalah Struktural Equation Model (SEM) dengan alat analsisSmart-PLS. Hasil Penelitian menunjukkan bahwa aktualisasi diri memberikan pengaruh yang positif dan signifikanterhadap kinerja karyawan PT. PLN (Persero) Distribusi Jakarta Raya dan Tangerang. Kemudian penghargaanjuga memberikan pengaruh yang positif dan signifikan terhadap kinerja karyawan PT. PLN (Persero) DistribusiJakarta Raya dan Tangerang. Universitas Mercu Buana 2016-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3831 10.22441/jimb.v2i3.3831 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 3 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 799-818 2655-7274 2460-8424 10.22441/jimb.v2i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3831/2004 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3863 2018-09-10T03:08:00Z jimb:ART driver

PENGARUH PROFITABILITAS, CASH POSITION, KEBIJAKAN UTANG, DAN UKURAN PERUSAHAAN TERHADAP KEBIJAKAN DIVIDEN PADA PERUSAHAAN MANUFAKTUR YANG TERDAFTAR DI BEI PERIODE 2010 – 2012 Sha, Thio Lie Kebijaksanaan dividen; profitabilitas; cash position; kebijakan utang; ukuran perusahaan; Tujuan penelitian adalah untuk menguji pengaruh profitabilitas, cash position, kebijakanutang, dan ukuran perusahaan terhadap kebijakan dividen; Sampel yang digunakan adalahperusahaan manufaktur yang terdaftar di BEI periode 2010-2012. Pengambilan sampeldilakukan untuk melihat pengaruh dari profitabilitas, cash position, kebijakan utang, danukuran perusahaan secara langsung. Hasil analisis regresi berganda secara simultan/bersama-sama menunjukan bahwa profitabilitas, cash position, kebijakan utang danukuran perusahaan memiliki pengaruh yang signifikan. Secara parsial, profitabilitasmemiliki pengaruh yang signifikan dan positif terhadap kebijakan dividen; cash positionmemiliki pengaruh yang tidak signifikan dan positif; kebijakan utang dan ukuran perusahaan memiliki pengaruh yang tidak signifikan dan negatif terhadap kebijakan dividen. Universitas Mercu Buana 2017-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3863 10.22441/jimb.v3i3.3863 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 3 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 432-443 2655-7274 2460-8424 10.22441/jimb.v3i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3863/2031 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/8891 2020-12-15T10:49:05Z jimb:ART driver

STRATEGI INOVASI MODEL BISNIS RITEL MODERN DI ERA INDUSTRI 4.0 Ong, Johan Oscar Sutawijaya, Achmad H Saluy, Ahmad Badawi Keunggulan Kompetitif yang berkelanjutan, model bisnis ritel berkelanjutan, ritel industri 4.0 Bisnis ritel modern kategori minimarket di Indonesia mencatat pertumbuhan yang terus berlanjut dari tahun ke tahun.  Hal ini ditandai dengan peritel besar yang mampu terus membukukan pertumbuhan bisnis rata-rata 9% per tahun. Peritel besar raksasa yaitu Alfamart dan Indomaret sukses menjalankan bisnis ritel minimarket ini, namun berbeda halnya dengan minimarket 7 Eleven (Sevel) yang tutup sejak 30 juni 2017. Secara bisnis, Sevel menawarkan produk dan service yang lebih lengkap daripada Alfamart dan Indomaret. Sevel Indonesia dengan inovasi bisnisnya yang menawarkan makanan dan minuman ready to eat lengkap dengan area untuk duduk serta jaringan internet gratis, terlihat sangat menjanjikan dan sempat sangat berhasil di tahun 2014, namun pada akhirnya tutup. Di era 4.0 ini menjadi tantangan tersendiri bagi bisnis ritel dimana kelangsungan bisnis harus dapat diselaraskan dengan perkembangan teknologi untuk memenuhi ekspektasi dan keinginan konsumen. Penelitian menggunakan metode analisa deskriptif dengan melakukan review literatur yang mendukung dan menggunakan pendekatan model Sustainable Growth Retail Business Model. Value chain analysis digunakan untuk menjabarkan value yang ditingkatkan pada proses bisnis retail kategori minimarket ini. Penelitian ini menghasilkan model bisnis ritel yang dapat tumbuh berkelanjutan dengan menggunakan output bisnis sebagai tujuan akhir yang akan dicapai. Universitas Mercu Buana 2020-07-27 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8891 10.22441/jimb.v6i2.8891 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 2 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 201 - 210 2655-7274 2460-8424 10.22441/jimb.v6i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8891/3598 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3540 2018-09-03T04:11:29Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3628 2018-08-29T09:53:08Z jimb:ART driver

PENGARUH PENEMPATAN KERJA DAN MOTIVASI TERHADAP KINERJA CADDY PT GADING RAYA GOLF, SERPONG – TANGERANG Soelton, Mochamad Widayati, Catur mployment; Motivation and Performance Problems faced by management of Golf and Country club are the low-performance Caddy and allegedlyinfluenced by various factors, among others, Employment and Motivation.To analyze the problem, then use the method of multiple linear regression analysis. The study wasconducted on 100 respondents with saturated samples (census methods). The purpose of this study was toanalyze the influence of Employment, Motivation to Performance Caddy. From the test results obtainedregression independent variables Employment and fairly strong positive correlation (R) 0.559 with significant values 0.00 (<0.01), for the independent variable motivation and positive correlation (R) 0.637with a strong significant 0.00 ( <0.01). R-square value indicates the value of 0.469, it could mean that46.9% Performance of Caddy PT. Gading Raya Golf can be explained by the variable Employment andmotivation, the remaining 53.1% is explained by other variables. Performance Caddy conclusion is affectedby the Employment and Motivation. It is therefore advisable to strengthen continuous training, especiallyrelating to the rule of golf, product knowledge of golf. Universitas Mercu Buana 2015-06-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3628 10.22441/jimb.v1i2.3628 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 2 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 194-208 2655-7274 2460-8424 10.22441/jimb.v1i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3628/1890 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3524 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/560 2018-08-25T04:29:54Z jimb:ART driver

ANALISIS PERBANDINGAN LOYALITAS KONSUMEN BLACKBERRY SEBELUM DAN SESUDAH ADANYA BBM FOR ANDROID, DAN FAKTOR-FAKTOR YANG MEMPENGARUHINYA Nemeth, Gabor Fitriyani, Eka This research aims to analyze the comparison of consumer loyalty before and after the emergence of BBM For Android and the factors that influence it.This research is a comparative study. The analysis tool in research methods used are test instruments, different test and factor analysis test.  Research results with different test T-Paired shows that the value of T count (5.571) > T table (0.676) and the Sig. (0,000) <a (0.05) which means that there is a difference of consumer loyalty before and after the emergence of BBM For Android, which is where the differences it shows a decrease of loyalty with an average decrease of 4,243. And analysis of test factors using the KMO Bartlett's test said that factors used tested the feasibility with the value 0,875, and the most dominant factor in influencing consumer loyalty is the satisfaction felt by consumers and Brand Image.  Suggestions for further research, should expand the factors research and improved research in order to obtain more accurate results. Keywords : Consumer Loyalty, Factors of Consumer Loyalty Universitas Mercu Buana 2016-05-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/560 10.22441/jimb.v1i1.560 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 1 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 22-28 2655-7274 2460-8424 10.22441/jimb.v1i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/560/491 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/20585 2023-12-02T02:57:17Z jimb:ART driver

The Influence Analysis Position on The Employee Performance of SMK PGRI Telagasari Karawang Regency Maolani, Fakhri Mujahid Solehudin, Solehudin Job Analysis; Employee Performance This study aims to determine, analyze, and explain the effect of job analysis on the employee’s performance of SMK PGRI Telagasari Karawang. This research uses descriptive analysis and verification methods with a quantitative approach. The population in this study were users of SMK PGRI Telagasari Karawang Regency, the sample in this study was 85 respondents. The sampling technique used in this research is a saturated sample, namely taking respondents using the population as the research sample. The analysis technique used in this study is multiple linear regression analysis. The results showed that there was a significant effect of job analysis on employee performance at SMK PGRI Telagasari, Karawang Regency. The magnitude of the influence of job analysis on the performance of employees of SMK PGRI Telagasari Karawang Regency is 89.4%. While the remaining 10.6% is explained by other factors not examined in this study. Universitas Mercu Buana 2023-08-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/20585 10.22441/jimb.v9i2.20585 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 2 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 162-170 2655-7274 2460-8424 10.22441/jimb.v9i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/20585/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5609 2019-05-07T05:59:51Z jimb:ART driver

PERAN PROMOSI DALAM MENINGKATKAN LOYALITAS KONSUMEN OJEK ONLINE Nugroho, Arissetyanto Promosi, Keamanan, Tingkat Kepercayaan, Loyalitas Pelanggan, Ojek Online. Layanan ojek telah bertransformasi dari ojek yang ada dipangkalan, menjadi ojek yang dapat dipanggil melalui aplikasi teknologi. Fenomena ini yang disebut dengan ojek berbasis online. Melalui aplikasi teknologi, konsumen dapat memperoleh kemudahan dengan memesan dimanapun dan kapanpun saja, konsumen juga memperoleh penanda lokasi yang akan memudahkan driver ojek online untuk mendatangi lokasi konsumen, selain itu juga aplikasi ini memberikan kemudahan interaksi antara perusahaan ojek online, driver, dan juga konsumen. Di dalam penelitian ini, beberapa variabel yang diuji adalah variabel promosi, keamanan, tingkat kepercayaan dalam mempengaruhi loyalitas pelanggan ojek online. Variabel ini dipilih karena aplikasi yang dimanfaatkan oleh ojek online menyampaikan banyak informasi promosi kepada pelanggan melalui sistem yang disediakan dari teknologi tersebut, selain itu karena layanan ini adalah layanan baru maka tingkat keamanan dan kepercayaan dari konsumen merupakan hal yang penting untuk diuji dalam hubungannya terhadap loyalitas pelanggan ojek online. Hasil dari penelitian ini menunjukkan bahwa tiga variabel dependen yaitu promosi, tingkat kepercayaan, dan keamanan memengaruhi loyalitas pelanggan, namun ada variabel sentral yaitu promosi yang memengaruhi keamanan dengan menyampaikan berbagai hal-hal yang dapat meningkatkan pemahaman untuk layanan ojek online. Keamanan ini kemudian merupakan prasyarat untuk bisa meningkatkan kepercayaan konsumen, yang akhirya dapat memengaruhi konsumen mencoba dan kemudian melakukan repeat order atau mau menggunakan layanan tersebut kembali. Data penelitian dilakukan dengan survei kepada 100 responden, selanjutnya data di bootstrap hingga mencapai 500 sampel dan analisa Structural Equation Modelling dilakukan dengan menggunakan Smart PLS. Hasil penelitian menyampaikan bahwa hubungan tidak langsung dari variabel promosi memengaruhi keamanan, memmengaruhi tingkat kepercayaan dan kemudian tingkat kepercayaan akhirnya bisa memengaruhi loyalitas. Jalur ini adalah jalur yang paling signifikan memengaruhi loyalitas pelanggan ojek online. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5609 10.22441/jimb.v4i3.5609 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 3 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 295 - 308 2655-7274 2460-8424 10.22441/jimb.v4i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5609/2550 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/10743 2021-03-31T18:44:00Z jimb:ART driver

THE IMPACT OF INSTAGRAM AS A SOCIAL MEDIA TOOL ON CONSUMER PURCHASE DECISION ON NIKE Diantari, Ni Putu Eni Jokhu, Jean Richard Instagram, Celebrity Endorsement, Instagram Advertising, Electronic Word of Mouth (E-WOM) The world has been changed and globalized with technology's revolution with communication and the spread of information, while social media is now known as an important part of marketing strategies. Instagram is one of the social media platforms that most people use. Nike is one of the market leaders sneakers brand in the world but in Indonesia, there is a decreasing band index of Nike in the last three years. Therefore, the researcher conducted a study to analyze the factor that could influence customer purchase decisions and focused on Nike brands. This study using celebrity endorsement, Instagram advertising, E-WOM, perceived quality as the X variable with brand awareness as a mediating variable. This research used a quantitative method using PLS-SEM to analyze the respondent (n= 305) who in age 20-40 which is the Millennials generation. The result showed that perceived quality did not significantly influence both purchase decision and brand awareness. Whereas celebrity endorsement, Instagram advertising, and E-WOM significantly influence consumer purchase decisions and brand awareness. This research also found that brand awareness has a positive relationship with the purchase decision. Universitas Mercu Buana 2021-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10743 10.22441/jimb.v7i1.10743 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 1 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 116-127 2655-7274 2460-8424 10.22441/jimb.v7i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10743/4363 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3547 2018-08-25T05:35:19Z jimb:ART driver

PENGARUH PROSES REKRUTMEN, PELATIHAN DAN PENGEMBANGAN KARIR TERHADAP PRESTASI KERJA (Studi Kasus Pada PT AIA Financial) Junaedi, Junaedi Pramudito, Onggo Widayati, Catur Ratwidita, Reshi process recruitment; training; career development and job performance; This thesis discusses the influence of the process recruitment, training and careerdevelopment on job performance. The data obtained by disseminating questionnaires to 50respondent employees of PT AIA Financial. Data tested by using path analysis. And todetermine whether there is influence between process recruitment with the jobperformance, whether there is influence between training with the job performance,whether there is influence between career development with the job performance andwhether there is influence process recruitment, training and career development togetheron job performance this research is done in PT AIA Financial, Pancoran, South Jakarta.Variables used in this thesis is the process of recruitment, variables training, variablescareer development and variables job performance. Therefore, analysis of the data used istest validity and reliability testing. The test results showed that the research hypothesisprocess of recruitment positive and significant influence to job performance, trainingpositive and significant influence to the job performance and career development positiveand significant influence to the job performance. Universitas Mercu Buana 2018-08-24 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3547 10.22441/jimb.v3i1.3547 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 1 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 71-91 2655-7274 2460-8424 10.22441/jimb.v3i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3547/1881 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3854 2018-09-10T02:45:40Z jimb:ART driver

PENERAPAN PROMOSI JABATAN DALAM PENINGKATAN MOTIVASI KERJA PADA GURU DAN PEGAWAI YAYASAN MANBA’UL ULUM KOTA SERANG BANTEN Romli, Ombi Promosi Jabatan; Motivasi Kerja; Variabel penelitian ada dua, yaitu promosi jabatan sebagai variabel bebas dan motivasi kerjakaryawan sebagai variabel terikat. Pelaksanaan promosi akan berpengaruh pada motivasi kerjatenaga kerja. Secara umum, apabila suatu organisasi melaksanakan promosi jabatan dengan adildan objektif, maka motivasi kerja tenaga kerja dapat meningkat. Metode penelitian yang penelitigunakan dalam penelitian ini adalah dengan menggunakan metode deskriptif, asosiatif, dankuantitatif. Hipotesis yang digunakan adalah hipotesis parsial, sedangkan untuk analisis datamenggunakan analisis koefisien regresi linier sederhana dan koefisien determinan. Populasi dansampel penelitian ini adalah seluruh pegawai dan guru dan pegawai Yayasan Manba’ul UlumKota Serang Banten yakni sebanyak 64 orang. Hasil penelitian menunjukkan bahwa metoderegresi linier sederhana yang digunakan untuk melihat bagaimana pengaruh promosi jabatanterhadap motivasi kerja pegawai yang dilakukan pada 64 orang pada guru dan pegawai YayasanManba’ul Ulum Kota Serang Banten, diperoleh nilai koefisien regresi Y = 31,935 + 0,530X.Konstanta (a) bernilai 31,935, menunjukkan nilai konstanta, di mana jika nilai variabelindependen = 0, maka motivasi kerja pegawai (Y) adalah sebesar 31,935. Koefisien regresipromosi jabatan (X) sebesar 0,530, menunjukkan bahwa variabel promosi jabatan (X)berpengaruh positif terhadap motivasi kerja pegawai (Y). Dengan kata lain, jika promosi jabatanditingkatkan sebesar satu satuan, maka motivasi kerja guru dan pegawai Yayasan Manba’ulUlum Kota Serang Bantenakan meningkat sebesar 0,530. Tabel model summary menunjukkanbahwa nilai R = 0,602, berarti hubungan antara variabel promosi jabatan terhadap motivasi kerjapegawai adalah sebesar 60,2%, artinya hubungannya erat. Sedangkan nilai R square adalahsebesar 0,362, berarti sebesar 36,2% motivasi kerja pegawai dapat dipengaruhi oleh variabelpromosi jabatan, sedangkan sisanya sebesar 63,8% dapat dijelaskan oleh faktor lain di luarpenelitian yang tidak diteliti dalam penelitian ini. Universitas Mercu Buana 2017-07-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3854 10.22441/jimb.v3i2.3854 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 2 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 284-297 2655-7274 2460-8424 10.22441/jimb.v3i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3854/2022 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3531 2018-09-03T04:11:29Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3691 2018-09-03T03:31:05Z jimb:ART driver

PENGARUH DISIPLIN DAN MOTIVASI KERJA TERHADAP KINERJA PEGAWAI PADA DINAS SENTRA OPERASI TERMINAL PT.ANGKASA PURA II Khumaedi, Evawati Disiplin; Motivasi Kerja dan Kinerja Pegawai; Dalam penelitian ini membahas Pengaruh antara Disiplin dan Motivasi Kerja terhadap Kinerja Pegawai PT.Angkasa Pura II. Data diperoleh dengan memberikan kuesioner kepada 38 orang pegawai sebagairesponden. Hipotesis yang dilakukan adalah diduga adanya pengaruh antara disiplin dan motivasi kerjaterhadap kinerja pegawai PT. Angkasa Pura II.Dengan menggunakan alat uji analisis SPSS maka didapat nilai pada tabel Model Summary nilai R sebesar 0,627, artinya menunjukkan hubungan yang kuat. R squareadalah koefisien determinasi yang menunjukkan persentase pengaruh variabel X1 dan X2 terhadap Y. NilaiR square sebesar 0,393 menunjukkan bahwa pengaruh X1 dan X2 secara bersama-sama (simultan)terhadap Y adalah sebesar 39,3%, sedangkan sisanya (100% - 39,3%) dipengaruhi oleh faktor lain.Persamaan regresi yang terbentuk Y = 21,015 + 0,396 X1 + 0,278 Xtanda positif berarti apabila Disiplin(X1) dan Motivasi (X2) ditingkatkan maka dapat menambah Kinerja Pegawai Pelayanan Kebandarudaraan(Y). Universitas Mercu Buana 2016-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3691 10.22441/jimb.v2i1.3691 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 1 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 486-497 2655-7274 2460-8424 10.22441/jimb.v2i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3691/1902 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/33502 2025-08-20T14:28:46Z jimb:ART driver

Implementation of Marketing and Digital Marketing Project to Increase Sales of Griya Hijau Hidroponik Smes in Bandung City Haryanto, Fara Tazkia Pramudya Zaqiyah, Siti Prasetyo, Andreas Recki Digital Marketing; Hydroponics Sales Conversion; Marketing Strategy; Search Engine Optimization; Social Media Management Griya Hijau Hidroponik has not yet fully utilized digital marketing in increasing visibility on search engines, expanding marketing reach via social media, and increasing sales conversions of harvested produce. This project applies an interview method to find out the problems faced in marketing Griya Hijau Hidroponik and a questionnaire filling method to find out market conditions. Approach the problem using marketing and digital marketing capstone project methods. The implemented strategies include rebranding, website redesign, implementing on-page SEO through creating articles, implementing off-page SEO through creating Linktree, implementing content marketing through creating Instagram content, creating Google Search Ads, and activating sales through the Shopee marketplace. As a result, the project achieved 363 website visitors with a 1.94% ad click-through rate, a 13.8% increase in Instagram followers with 2.35% engagement, and a sales conversion improvement of 7.23% in the first month and 75.3% in the second month. This project offers relevant empirical data for academics and researchers to further analyze the link between digital marketing utilization and SME sales growth. Universitas Mercu Buana D4 Digital Marketing Study Program, Faculty of Economic and Business, Padjadjaran University 2025-07-28 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33502 10.22441/jimb.v11i2.33502 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 2 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 174-188 2655-7274 2460-8424 10.22441/jimb.v11i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33502/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/2569 2018-08-24T12:51:57Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/24870 2024-08-08T16:56:36Z jimb:ART driver

Market Metamorphosis: Decoding The Marketing Mix Landscape in The Traditional Market of Cisalak, Depok, Indonesia, Amid The E-Commerce Epoch WB Raharjo, Ari Elida, Tety traditional market; e commerce; product; marketing mix The rapid development of e-commerce and the Covid-19 pandemic have led consumers to adopt new shopping habits from home. This situation initially resulted in the closure of offline stores and traditional markets. Currently, some offline stores have begun to reopen, and traditional markets have played a role in the local economy. Amid the current rapid development of e-commerce and the changing consumer behavior, the phenomenon of traditional markets that continue to thrive is intriguing to investigate. The aim of this research is to understand the perceptions of consumers in Cisalak Market, Depok, and e-commerce regarding products, prices, promotions, and locations. This study employs descriptive methods and validity, reliability, and Mann-Whitney tests with 100 respondents from Cisalak Market consumers in Depok. A questionnaire is used to collect data on variables such as products, prices, promotions, and locations in traditional markets and e-commerce. The results show that customer perceptions of products in traditional markets differ from those in e-commerce. Meanwhile, perceptions of prices, promotions, and locations do not significantly differ between traditional markets and e-commerce. Universitas Mercu Buana 2024-08-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/24870 10.22441/jimb.v10i2.24870 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 2 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 186-194 2655-7274 2460-8424 10.22441/jimb.v10i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/24870/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/24870/5734 Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6937 2020-07-27T02:42:04Z jimb:ART driver

FAKTOR FAKTOR YANG MEMPENGARUHI HASIL AGRIBISNIS TANAMAN PANGAN DAN PENGARUHNYA TERHADAP KESEMPATAN KERJA DI PROVINSI JAWA BARAT Mulyadi, Dudung Lahan Pertanian, Modal Usaha, Teknologi, Pemasaran Produk, Sumber Daya Manusia, Kesempatan Kerja Penelitian ini menggunakan metode eksplanatori yang menjelaskan hubungan kausal antara beberapa faktor yang terkait dengan kesejahteraan rumah tangga petani di wilayah Jawa Barat. Data disusun dalam bentuk cross-sectional antar rumah tangga petani dari 17 kabupaten di Propinsi Jawa Barat.  Model penelitian diformulasikan sebagai model Cobb-Douglas dan analisis menggunakan regresi linier melalui metode Ordinary Least Square(OLS).Temuan penelitian adalah : (1) secara simultan Lahan pertanian, modal usaha, teknologi pemasaran produk dan sumbar daya manusia berpengaruh positif terhadap kesempatan kerja ; (2) secara parsial Lahan pertanian, modal usaha, dan pemasaran produk berpengaruh signikan terhadap kesempatan kerja, sedangkan teknologi dan sumber daya manusia tidak berpengaruh signifikan terhadap kesempatan kerja. Hasil penelitian menunjukkan bahwa pengunaan lahan pertanian, penambahan bantuan modal usaha, penerapan teknologi, pemasaran pruduk yang terkelola dengan baik dan sumber daya manusia yang baik dapat meningkatkan agribisnis tanaman pangan. Semakin baik agribisnis dikelola maka akan meningkatkan kesempatan kerja di Provinsi Jawa Barat. Universitas Mercu Buana 2019-12-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6937 10.22441/jimb.v5i3.6937 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 3 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 226-240 2655-7274 2460-8424 10.22441/jimb.v5i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6937/2989 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/15030 2022-08-02T07:18:30Z jimb:ART driver

The Antecedents And Consequences Of Trust In Online Retail Andika, Marisa Fitria Pratomo, Luki Adiati Damayanti, Sisca Service Quality, Trust In The Retail, Intention To Recommendation, Online Retail This study examines the antecedents and consequences of trust in online retail in the area of Jabodetabek. Samples were consumers who have shopped at online retail (Tokopedia), totaling 200 respondents. They were selected using the non-probability sampling method with a purposive sampling technique. The collected data were analyzed using Structural Equation Modeling. Results indicated that the complementary of interaction quality, complementary of environment quality, and complementary of outcome quality have a positive effect on trust in the retailer. Likewise, trust in the retailer has a positive effect on the intention to recommendations.  Universitas Mercu Buana 2022-08-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15030 10.22441/jimb.v8i2.15030 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 2 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 149-161 2655-7274 2460-8424 10.22441/jimb.v8i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15030/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/15030/2975 Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/10291 2020-12-15T10:40:37Z jimb:ART driver

Pengaruh Pengembangan Karir, Kepemimpinan Transformasional Dan Kepuasan Kerja Terhadap Keterikatan Karyawan (Studi pada Karyawan Departemen Business Development PT BFI Finance Indonesia Tbk) Paijan, Paijan Rumaharbo, Astri Pengembangan Karir, Kepemimpinan Transformasional, Kepuasan Kerja dan Keterikatan Karyawan. Penelitian ini bertujuan untuk mengetahui pengaruh pengembangan karir, kepemimpinan transformasional dankepuasan kerja terhadap keterikatan karyawan departemen business development. Jenis penelitian yangdigunakan dalam penelitian ini adalah kuantitatif dan serta metode penelitian yang dipakai adalah metodepenjelasan. Sampel yang diambil sebanyak 83 karyawan dengan menggunakan teknik purposive sampling.Teknik analisis yang digunakan adalah analisis statistik deskriptif dan analisis regresi linier berganda. Hasilpenelitian ini menunjukan bahwa variabel pengembangan karir, kepemimpinan transformasional, kepuasankerja berpengaruh positif dan signikan terhadap Keterikatan Karyawan Universitas Mercu Buana 2020-12-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10291 10.22441/jimb.v6i3.10291 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 3 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 305 - 323 2655-7274 2460-8424 10.22441/jimb.v6i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10291/4002 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3701 2018-09-03T06:58:47Z jimb:ART driver

MENINGKATKAN PERAN DAN NILAI STRATEGIS MSDM UNTUK MENUNJANG DAYA SAING ORGANISASI, PERSPEKTIF: COMPETENCE DAN TALENT MANAGEMENT Perkasa, Didin Hikmah Perandan Nilai Strategis SDM; Kompetensi; Talent Management; Berbagai pengaruh perubahan yang terjadi menuntut organisasi untuk membuka diri terhadap tuntutanperubahan dan berupaya menyusun strategi dan kebijakan yang selaras dengan perubahan lingkunganbisnis.Artinya suatu organisasi mampu menyusun strategi dan kebijakan yang ampuh untuk mengatasisetiap perubahan yang terjadi. Keberhasilan penyusunan kebijakan dan strategi organisasi akan didukunglebih banyak fungsi manajerial yang ada.Salah satu bidang fungsional strategi yang menjadi perhatianadalah Manajemen Sumber Daya Manusia.Organisasi yang mempunyai karyawan dengan kompetensi dantalentyangsesuaidengankebutuhanperusahaanakanmembuatperusahaanlebihkompetitif. Universitas Mercu Buana 2016-07-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3701 10.22441/jimb.v2i2.3701 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 2 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 612-625 2655-7274 2460-8424 10.22441/jimb.v2i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3701/1910 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/592 2018-09-03T03:15:44Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/577 2018-09-03T02:57:19Z jimb:ART driver

ANALISIS DAMPAK KUALITAS PELAYANAN AKADEMIK TERHADAP LOYALITAS MAHASISWA DENGAN KEPUASAN MAHASISWA SEBAGAI VARIABEL INTERVENING Hanafiah, Ali The aim of this study was 1) to determine and analyze the effect of quality of academic services to the satisfaction of students in the graduate program Mercu Buana University, 2) To know and analyze the influence of Quality of Academic Services for loyalty Students in graduate programs Mercu Buana University, 3) To know and analyze the influence of the Student Satisfaction Loyalty program graduate student at the University of Mercu Buana, and 4) To determine and analyze the effect of quality of academic services to students through Student Satisfaction Loyalty program Mercu Buana University graduate. Data analysis method used in analyzing the influence or relationship between the dependent variable and independent variables through an intervening variable. The method used is the analysis Path (Path Analysis). The results showed a significant difference between the quality of academic services for student satisfaction, it can be interpreted that if the quality of academic services performed Mercu Buana University graduate programs to students further improved, it will increase student satisfaction. The quality of academic services affect the loyalty of students, giving the sense that the higher the quality of academic services provided to the students, the more it will increase the loyalty of the students in the use of educational services in the graduate program Mercu Buana University. There is a significant relationship between student satisfaction to loyalty of students, it can be interpreted that if the level of student satisfaction increases, the loyalty of the student will also increase. Student satisfaction is able to become an intervening variable between academic service quality and loyalty of students, it can be interpreted that the higher the quality of academic services provided, it will increase the level of satisfaction of the students, so it will have an impact on increasing the loyalty of the students.Keywords: Academic Services satisfaction, student satisfaction and loyalty. Universitas Mercu Buana 2016-05-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/577 10.22441/jimb.v1i3.577 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 3 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 348-367 2655-7274 2460-8424 10.22441/jimb.v1i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/577/505 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/32366 2025-04-10T02:03:31Z jimb:ART driver

The Influence of Brand Ambassador, Brand Image, and Brand Awareness on Decisions to Purchase Skincare Ariany, Eka Wangdra, Yvonne Brand Ambassador; Brand Image; Brand Awareness; Purchasing Decision This research aims to analyze the influence of Brand Ambassador, Brand Image, and Brand Awareness on purchasing decisions for Skintific skincare products in Batam City. In the highly competitive skin care industry, these factors are believed to influence consumers' decisions to purchase products. The method used in this research is a quantitative approach with a survey design, where data is collected through questionnaires distributed to 385 respondents who are Skintific consumers in Batam City. Data analysis was carried out using the multiple linear regression method to test the relationship between the independent variables (Brand Ambassador, Brand Image and Brand Awareness) and the dependent variable (Purchase Decision). The research results show that Brand Ambassador, Brand Image, and Brand Awareness have a significant positive influence on purchasing decisions for Skintific products. Among these three factors, Brand Ambassador shows the greatest influence on purchasing decisions. This research also found that Brand Image and Brand Awareness play an important role in shaping consumer perceptions and increasing intentions to purchase Skintific skincare products. Based on these findings, it is recommended that Skintific strengthen their marketing strategy by selecting relevant brand ambassadors, strengthening a positive brand image, and increasing brand awareness among consumers through various marketing channels. Universitas Mercu Buana 2025-04-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32366 10.22441/jimb.v11i1.32366 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 1 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 76-86 2655-7274 2460-8424 10.22441/jimb.v11i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32366/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3497 2018-08-24T07:02:50Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/23820 2024-03-31T13:25:30Z jimb:ART driver

The Influence of Hedonic Shopping Motivation, Ease of Use, Customer Reviews, and Electronic Word of Mouth on Impulse Buying Behavior at Shopee E-Commerce During The COVID-19 Pandemic Mirahanda, Theresia Angel Parmariza, Yennida Hedonic Shopping Motivation; Ease of Use; Customer Reviews; Electronic Word of Mouth; E-commerce. This study aims to determine, analyze, and explain the effect of hedonic shopping motivation, ease of use, customer reviews, and electronic word of mouth on impulse buying behavior at E-commerce Shopee during the COVID-19 pandemic. The approach used in this research is descriptive method and quantitative approach. The data analysis method in this study uses Partial Least Square (PLS) and data collection in this study uses a survey method, with the research instrument used is a questionnaire. The population in this study are people who shop using Shopee, the number of which is not known with certainty. The sample used in this study was 211 respondents, with the sampling technique using purposive sampling. The results of this study indicate that hedonic shopping motivation has a positive and significant effect on impulse buying behavior; customer reviews have a positive and significant effect on impulse buying behavior; electronic word of mouth has a positive and significant effect on impulse buying behavior; ease of use has no effect on impulse buying behavior. Universitas Mercu Buana 2024-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/23820 10.22441/jimb.v10i1.23820 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 1 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 53-80 2655-7274 2460-8424 10.22441/jimb.v10i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/23820/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/23820/5461 Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6843 2019-09-05T10:07:57Z jimb:ART driver

MEMBENTUK KINERJA KARYAWAN DENGAN MEMINIMALKAN PERILAKU MENGELUH KARYAWAN Susanty, Lulu Agrina Soelton, Mochamad Wahyudiono, Bambang Abadi, YudhaB. Hatmo, Bayu Perilaku Mengeluh, Komitmen Karyawan, Kecerdasan Emosional, Kinerja Karyawan. Penelitian ini bertujuan untuk menguji dan menganalisis pengaruh perilaku komplain, komitmen karyawan dan kecerdasan emosi terhadap kinerja karyawan pada PT. PGN MAS. Metode yang digunakan dalam penelitian ini adalah metode deskriptif. Objek penelitian ini adalah 75 karyawan PT. PGN MAS. Pendekatan yang digunakan dalam penelitian ini adalah Model Persamaan Struktural Komponen atau Varians dengan alat analisis Smart-PLS. Hasil penelitian menunjukkan perilaku mengeluh yang berpengaruh negatif dan signifikan terhadap kinerja karyawan. Komitmen karyawan yang berpengaruh positif dan signifikan terhadap kinerja karyawan. Kecerdasan emosional yang berpengaruh positif dan signifikan terhadap kinerja karyawan. Universitas Mercu Buana 2019-09-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6843 10.22441/jimb.v5i2.6843 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 2 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 266 - 288 2655-7274 2460-8424 10.22441/jimb.v5i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6843/2880 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/14233 2022-10-07T09:28:10Z jimb:ART driver

The Influence Of The Website's Atmosphere On Online Consumer Behavior And Its Relationship To Flow: Case Study Of Online Travel In Indonesia Kurniawan, Nanang F Madiasto, Eko Soesilo, Primidya KM In this decade, studies of website atmospherics and flow experiences have received much attention from researchers and are very broad. At present, there are still few fields of study that study the relationship between the atmosphere website and a flow experience. In this study aims to examine the factors that have an impact on website atmospherics and flow experiences that can affect consumer behavior (Enjoyment shopping, Intimacy, and Intention) in the use of online travel services websites in Indonesia. In the development of this study, using the stimulus-organism-response (S-O-R) framework as a theoretical basis, the findings of this study are expected to show that the design atmosphere in websites has a positive impact on improving the enjoyment shopping, Intimacy and Intention of purchases for online travel agents in Indonesia. Universitas Mercu Buana 2022-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14233 10.22441/jimb.v8i1.14233 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 1 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 16-39 2655-7274 2460-8424 10.22441/jimb.v8i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14233/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/12204 2023-11-30T15:11:24Z jimb:ART driver

Descriptive Study of Organizational Climate in Higher Education Astari, Karima Kadiyono, Anissa Lestari Ashriyana, Rezki Climate, organizational climate, faculty X, university Y Climate is what the members of the organization experience. Organizational climate is the atmosphere surrounding the organization, uniting the characteristics of individuals, organizations, and the environment that influences the behavior of individuals in the organization. Many studies have shown that organizational climate has a significant impact on job satisfaction and employee productivity. One of which is Faculty X, a new faculty member at University Y, who wishes to examine their current organizational climate. Therefore, study on climate is an essential tool for defining and understanding organizations, providing support for future improvement. This study aims to examine organizational climate of a faculty at a private university in Bandung city, namely Faculty X at University Y. This study used a quantitative approach with descriptive research method. The sample consisted of 30 education staff employees. The instrument used was the short version of Organization Climate Scale (CLIOR), consisting of 15 items. Reliability test was carried out using Cronbach's Alpha statistical method, with the result of 0.819. The results showed that the organizational climate of Faculty X at University Y was in the high category with indicators of cooperation, work organization, relations, innovation, participation, and attachment to the job. In short, the results of this study can provide a new understanding of perception about organizational climate of Faculty X at University Y. Creating organizational climate is essential because it can overcome organizational relationships. The high organizational climate can be beneficial for Faculty X as it can influence employees’ productivity which in turn can influence the effectiveness and efficiency of the organization. Universitas Mercu Buana 2023-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12204 10.22441/jimb.v9i1.12204 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 1 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 26-36 2655-7274 2460-8424 10.22441/jimb.v9i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/12204/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/38120 2026-04-04T08:45:13Z jimb:ART driver

THE INFLUENCE OF INTELLECTUAL CAPITAL, GREEN ACCOUNTING, AND COMPANY SIZE ON FINANCIAL PERFORMANCE IN MINING COMPANIES LISTED ON THE INDONESIAN STOCK EXCHANGE PERIOD 2020-2024 Andesto, Ronny Intellectual Capital; Green Accounting; Company Size; Financial Performance This study aims to see and analyze the impact produced by intellectual capital, green accounting, and company size on financial performance. The population in this study are all mining companies listed on the Indonesia Stock Exchange for the period 2020-2024. The sampling technique in this study is the perposive sampling technique by determining several sampling criteria,. The data analysis technique used in this study is to use Multiple Linear Regression with the help of SPSS Version 27. The results in this study indicate that intellectual capital, has an effect on financial performance; green accounting, and company size have no effect on financial performance.  Universitas Mercu Buana 2026-04-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/38120 10.22441/jimb.v12i1.38120 Jurnal Ilmiah Manajemen dan Bisnis; Vol 12, No 1 (2026): Jurnal Ilmiah Manajemen dan Bisnis; 59-72 2655-7274 2460-8424 10.22441/jimb.v12i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/38120/pdf Copyright (c) 2026 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/4398 2018-11-19T06:54:35Z jimb:ART driver

PENGARUH KOMPETENSI MENGGUNAKAN IT DAN KOMUNIKASI PEMASARAN TERHADAP KEUNGGULAN BERSAING E-COMMERCE BISNIS UMKM FASHION (Studi Kasus UMKM Jakarta Barat dan Tangerang Selatan) Perkasa, Didin Hikmah Utomo, Ahmad Juniarto Abidin, Zaenal competence of use information technology; marketing communications and competitive advantage; This study about marketing and production of fashion. The purpose of this study is to knowinfluence competence use information technology and marketing communicationscompanies to competitive advantage e-commerce business UMKM fashion (case studyUMKM West Jakarta and South Tangerang). This research subject is person UMKM WestJakarta and South Tangerang. The sample used in this study is 125 respondents. Makingtechniques sample use convenience sampling. Therefore, the analysis of the data usedanalysis statistic in the form of SEM PLS. Research this study show that the competenceuse information technology significant effect competitive advantage and marketingcommunications significant effect competitive advantage. Universitas Mercu Buana 2018-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4398 10.22441/jimb.v4i1.4398 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 1 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 39-52 2655-7274 2460-8424 10.22441/jimb.v4i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4398/2163 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3529 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/565 2018-08-25T04:29:54Z jimb:ART driver

PERBEDAAN GAYA KEPEMIMPINAN DALAM PERSPEKTIF MASKULIN dan FEMININ Parashakti, Ryani Dhyan At the present time there are enough women who are leaders and can work well in performing their duties and functions. There are at least five (5) requirements that have been met in order to achieve effective leadership are: (1) knowledge within the organization, (2) has a good reputation and school reports, (3) have the ability and strategic skills, (4) has a personality and high integrity, and (5) have high motivation power. Although sex differences that men and women are biologically, but in reality, gender is considered normal treatment is expected to be feminine women and men are expected to be masculine. Basically women and men having sex-role stereotypes that will affect their personality and behavior. The purpose of writing this article is to see whether the manager's leadership style differs from the male leadership styles of women managers and managers discuss how men and women describe their leadership style tendencies. This article discusses the characteristics of femininity and masculinity of some experts, transformational vs. transactional leadership style, as well as views of male managers and female managers on their leadership style.  Keywords : Leadership style, feminine vs. masculine, transformational vs. transactional leadership style Universitas Mercu Buana 2016-05-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/565 10.22441/jimb.v1i1.565 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 1 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 92-101 2655-7274 2460-8424 10.22441/jimb.v1i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/565/496 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/30379 2024-12-05T03:27:30Z jimb:ART driver

The Influence of Tourism Products and Promotion on Tourists' Visiting Decisions to A Water Park in Karawang Riady, Alya Astrid Suleman, Eman Tourism Products; Promotion; Visiting Decisions This study aims to determine the effect of tourism products and promotions on tourists' visiting decisions at Waterpark and to test and analyze tourism products and promotions on tourists' visiting decisions at Waterpark. The data were analyzed using path analysis and hypothesis testing using the t test and f test. Based on the results of the descriptive analysis of Tourism Products, it obtained an average score of 390.63 with the criteria for agreeing, Promotion got an average score of 347.71 with the criteria for agreeing, then on Customer Satisfaction it got an average score of 345.44 with the criteria for agreeing. Respondents analyzed tourism products and promotions on the decision to visit tourists a water park in Karawang which was good. Based on the results of the Tourism Product verification analysis with Promotion, it has a correlation of 0.640 and has a strong correlation level. Partially, it shows that price has an influence on tourists' visiting decisions, which is equal to 10.44%, this shows that the product has an effect on the decision to visit a water park in Karawang. Then, for the results of the partial research promotion of the decision to visit, which is equal to 51.78%, this shows that the promotion of the decision to visit at a water park in Karawang. While the simultaneous effect of tourism products and promotions on tourists' visiting decisions is equal to 62.22%, while the influence of other variables outside the research model is equal to 37.78%. Universitas Mercu Buana 2024-12-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/30379 10.22441/jimb.v10i3.30379 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 3 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 375-383 2655-7274 2460-8424 10.22441/jimb.v10i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/30379/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/15098 2022-12-15T10:40:39Z jimb:ART driver

The Effect of Transformational Leadership and Work Discipline Against The Employee Performance With Turnover Intention as The Intervening Variable Paijan, Paijan Transformational Leadership, Work Discipline, Turnover Intention, Employee Performance This study is to analyze the effect of transformational leadership, work discipline against the employee performance with turnover intention as the intervening variabel. The object of this research is the employees of PT. Prima Utama. This research was conducted on 270 respondents by using a quantitative descriptive approach. The determination of the sample size is using the Slovin formula so that the sample used is 161 respondents. Methods of data collection using survey methods, with the research instrument is using a questionnaire. The research method in this research is using Structural Equation Model (SEM). This study has stated that transformational leadership has a negative and significant effect on turnover intention. Work discipline has a negative and significant effect on turnover intention. Turnover intention has a negative and significant effect on employee performance. Transformational leadership has a positive and significant effect on employee performance and work discipline has a positive and significant effect on employee performance. Universitas Mercu Buana 2022-12-15 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15098 10.22441/jimb.v8i3.15098 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 3 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 331-346 2655-7274 2460-8424 10.22441/jimb.v8i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15098/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/23849 2023-12-07T03:09:20Z jimb:ART driver

Feasibility Analysis of Investing in Additional Vehicles at An Egg Distributor Iskandar, Yelita Anggiane Vikaliana, Resista Putri, Anggita Adiani Irawan, Arif Nugroho, Hanum Parinduri Amalia, Nur Annisa Irawan, Tito Altis Rolandiaz, Stenlee Investment Feasibility; NPV; Payback Period; IRR; Sum Off Years Digit Depreciation Business or investment feasibility analysis is research into a business plan that will analyze whether the investment to be made is feasible or not. Amalia Bintang Telur is located in the Cibitung area, Bekasi, West Java and has a branch located in Kalibata, South Jakarta which is the object of this research. This distributor has vehicles in the form of Grandmax type pick-up cars. The car's carrying capacity is 1800 kg. The problem faced by this distributor is that there are frequent delays due to a lack of vehicles for distribution, while there is high demand to be met. Usually, in dealing with these delays, distributors negotiate first with customers. If not addressed, the level of customer satisfaction with this distributor will decrease. There are several methods used to analyze the feasibility of an investment, namely, NPV, PP, Interest Rate (IRR) and Sum off Years Depreciation. It is concluded that the investment in adding a pick up car is worth doing, seen from the resulting positive NPV value of Rp. 942,260,893.38, based on the payback method this investment period is worth doing because the return occurs in the 1st year which produces a cumulative value of positive, the IRR investment method is worth investing in because the IRR value obtained is greater than the MARR used, namely 399% > 15%. For depreciation value, car prices tend to decrease every year. In the first year, the book value decreases by 19.44%, but after that, the depreciation in value will slow down with the depreciation percentage continuing to decrease by 2.34% until the eighth year. Universitas Mercu Buana 2023-12-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/23849 10.22441/jimb.v9i3.23849 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 3 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 355-368 2655-7274 2460-8424 10.22441/jimb.v9i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/23849/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5627 2019-12-12T10:28:12Z jimb:ART driver

ANALISIS PENGARUH RASIO LIKUIDITAS, SOLVABILITAS, AKTIVITAS DAN SIZE PERUSAHAAN TERHADAP KINERJA KEUANGAN PERUSAHAAN Puspitarini, Sari Current Ratio (CR), Debt to Equity Ratio (DER), Inventory Turn Over (InvTO), Total Asset Turn Over (TATO), Size perusahaan (SIZE), Return On Equity (ROE). Penelitian ini mengkaji pengaruh Current Ratio (CR), Debt to Equity Ratio (DER), Inventory Turn Over (InvTO), Total Asset Turn Over (TATO) dan SIZE perusahaan terhadap kinerja keuangan perusahaan atau Return On Equity (ROE). Penelitian menggunakan data emiten sektor Industri konsumsi yang terdaftar di Bursa Efek Indonesia periode 2011-2013. Metode sampling yang digunakan adalah purposive sampling. Dari populasi 111 perusahaan, 99 perusahaan memenuhi kriteria sebagai sampel. Metode analisis yang digunakan adalah analisis regresi linear berganda. Hasil penelitian menunjukkan bahwa secara parsial Current Ratio, Inventory Turn Over, Total Asset Turn Over, Ukuran Perusahaan (SIZE) berpengaruh positif dan signifikan terhadap ROE. Sedangkan Debt To Equity Ratio berpengaruh negatif dan tidak mempunyai pengaruh yang signifikan terhadap ROE. Total Asset Turn Over merupakan variabel yang paling besar pengaruhnya terhadap Return On Equity. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5627 10.22441/jimb.v5i1.5627 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 1 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 78 - 92 2655-7274 2460-8424 10.22441/jimb.v5i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5627/2566 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/13582 2021-11-30T15:43:04Z jimb:ART driver

The Moderating Effect Of Celebrity Preferences And Hedonism Personality On The Relationship Of Perceived Instrusiveness, Consumer Attention And Purchase Intention Anisah, Tiara Nur Miswanto, Miswanto Celebrity preference, hedonism personality, perceived intrusiveness, consumer attention, purchase intention, SOR Theory The study investigates the moderating effect of celebrity preference and hedonism personality on the relationship between perceived intrusiveness, consumer attention, and intention to purchase internet users by applying SOR Theory as a foundation. This study focuses on K-Popers among teenagers. A total of 400 samples were used in this study. The sample is split into two groups, with 200 samples including advertisements that fit the respondents' preferences and have a high hedonism personality and 200 samples containing advertisements that didn’t fit the respondents' preferences and have a low hedonism personality. Multi-group moderation was performed using AMOS ver.22 with the stats tools package software, and data were analyzed using IBM SPSS Statistics 16. As expected, the higher the level of distraction perceived by the user, the lower consumer attention to the advertisement. In contrast, the less distracted individuals are, the more attention they pay to commercials. Then, the more individuals pay attention to the ads, the more likely they are to make a purchase. According to additional research, celebrity preference and hedonism personality are proven to be moderate. Universitas Mercu Buana 2021-11-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13582 10.22441/jimb.v7i3.13582 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 3 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 324-339 2655-7274 2460-8424 10.22441/jimb.v7i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13582/4940 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/33717 2025-12-04T03:24:26Z jimb:ART driver

Design Thinking Approach in Designing Animal Care Services Based on Applications Safira, Handini Mirna Marthadinata, Agung Cahyawan, Risky Dwi Design Thinking; Pet Care Service; Service Innovation; Business Model Canvas This study aims to design a digital-based pet care service application to improve accessibility and service efficiency for pet owners in the Greater Jakarta area (Jabodetabek). The design thinking approach was used as the primary framework, consisting of five stages: empathize, define, ideate, prototype, and test. This study's implementation reached the prototype stage, presenting an initial visualization of the platform based on user needs. The business model was developed using the Business Model Canvas (BMC), covering nine key elements from key partners to revenue streams. Data were collected through questionnaires distributed to 45 pet owners in Jabodetabek using a purposive sampling technique and analyzed using qualitative and quantitative methods. The results indicate that most respondents face obstacles in accessing pet care services. Consequently, they expressed the need for several key features within the application to better facilitate their needs. The digital pet care business model was designed to address these demands by integrating various services into a single digital platform. Through the design thinking approach, the proposed solution is expected to enhance user experience and expand the reach of pet care services in Indonesia. Universitas Mercu Buana 2025-12-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33717 10.22441/jimb.v11i3.33717 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 3 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 306-318 2655-7274 2460-8424 10.22441/jimb.v11i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33717/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3837 2018-09-08T02:15:02Z jimb:ART driver

SISTEM PENUNJANG KEPUTUSAN (DECISION SUPPORT SYSTEM DSS ) UNTUK PEMILIHAN KARYAWAN BERPRESTASI DENGAN METODE SIMPLE ADDITIVE WEIGHTING (STUDI KASUS DI AKADEMI TELEKOMUNIKASI BOGOR) Nashar, Muhammad Sukamto, Anton Parashakti, Ryani Dhyan Sistem Pendukung Keputusan; Simple Additive Weighting, Karyawan; Berprestasi; Akademi Telekomunikasi Bogor; Karyawan merupakan faktor pendukung dalam sebuah perusahaan atau instansi, karena dengan adanyakaryawan yang memiliki standar kualifikasi perusahaan maka produktivitas perusahaan diharapkan akansemakin meningkat. Proses pemilihan karyawan berprestasi merupakan proses yang rumit danmemerlukan pertimbangan – pertimbangan yang cermat. Untuk memperoleh informasi yang cepat dan akurat akan prestasi kinerja karyawan yang tepat (memenuhi kriteria yang diharapkan), dibutuhkan suatuproses otomatisasi dengan menggunakan teknologi. Oleh karena itu kebutuhan sebuah sistem yangberbasis komputer dirasa sangat perlu guna memenuhi tuntutan akan kebutuhan informasi. Hal ini jugamengingat pemilihan karyawan berprestasi di Akademi Telekomunikasi Bogor masih di lakukan secaramanual. Hal inilah yang menjadi dasar penelitian. Penelitian yang dilakukan adalah membuat sebuahsistem yang dapat memberikan pertimbangan dalam melakukan pengambilan keputusan pemilihankaryawan berprestasi. Dengan menggunakan metode Simple Additive Weighting dalam pengolahan data,hal ini memungkinkan sistem dapat memberikan perangkingan sesuai dengan kualitas masing – masingkaryawan dan diharapkan dapat mempermudah pengambil keputusan dalam menentukan karyawanberprestasi. Hasil dari penelitian ini berbentuk sebuah sistem pendukung keputusan yang dapat mengolahdata pemilihan karyawan berprestasi menjadi sebuah pertimbangan yang valid. Dari hasil penelitiantersebut diharapkan pengambil keputusan menjadi terbantu dalam menentukan karyawan mana yangberprestasi dalam Akademi Telekomunikasi Bogor. Universitas Mercu Buana 2016-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3837 10.22441/jimb.v2i3.3837 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 3 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 882-891 2655-7274 2460-8424 10.22441/jimb.v2i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3837/2010 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/5937 2019-07-05T15:33:14Z jimb:ART driver

ANALISIS KINERJA REKSADANA SYARIAH DI INDONESIA PERIODE 2014-2016 Yuhasril, Yuhasril islamic mutual funds, sharpe, treynor, jensen, protected islamic mutual fund. This study aims to determine the performance of Islamic Mutual Funds in Indonesia in the period 2014 – 2016 and to know the type of Islamic Mutual Funds that have outperformance. Sample in this study as many as 23 mutual funds sharia in Indonesia are registered in the Financial Services Authority. The research design used is descriptive quantitative and Nett Asset Value data is processed by Sharpe Ratio, Treynor Ratio and Jensen Ratio. The results are 17 islamic mutual funds have a good performance, while 6 islamic mutual funds have a underperformance. The type of Islamic Mutual Fund that have outperformance is Protected. The second choice is Mixed or Stock which is can be used as alternative investment. Universitas Mercu Buana 2018-11-14 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5937 10.22441/jimb.v4i2.5937 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 2 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 185-197 2655-7274 2460-8424 10.22441/jimb.v4i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5937/2613 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/9723 2020-12-15T10:40:37Z jimb:ART driver

Ethical Leadership insight factor: Does it matters Ethical Climate and Organizational Commitments to step behavior towards maximum goals? Sintyaningsih, Putri Puspaningrum, Astrid Yuniarinto, Agung Jumadi, Jumadi Soelton, Mochamad Yuliantini, Tine Ethical Leadership, Job Satisfaction, Ethical Climate, Organizational Commitment, Passenger Service, PT Kereta Commuter Indonesia This study aims to determine the influence of Ethical Leadership on Job Satisfaction, Ethical Climate and Organizational Commitment at Frontliner Passenger Service West Region PT Kereta Commuter Indonesia. Data collection techniques are done by distributing questionnaires using ordinal scales. This research was conducted on 66 respondents by using quantitative descriptive approach and hypothesis testing. The collected data is then analyzed using the technique analysis Structural Equation Modeling (SEM) through SmartPLS (Partial Least Square) software. The results of this study show that Ethical Leadership positively and significantly influence on Ethical Climate, Job Satisfaction and Organizational Commitment at Frontliner Passenger Service West Region PT Kereta Commuter Indonesia.   Universitas Mercu Buana person 2020-12-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/9723 10.22441/jimb.v6i3.9723 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 3 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 263 - 272 2655-7274 2460-8424 10.22441/jimb.v6i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/9723/3993 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3684 2018-09-03T02:41:58Z jimb:ART driver

PENILAIAN KOMPETENSI GURU DI SD DELEGAN-2, SLEMAN, YOGYAKARTA Poerbowati, Sri Bayu, Retno evelopment of education; competence of teachers Along with the development of education and also demands the competence of teachers, theassessment of teacher competence is a matter which is currently required, both by schools and society ingeneral. SD Delegan-2 is used as an example to assess teacher competence in this study. SD Delegan-2 islocated in Sleman, Yogyakarta province were rebuilt by the private sector due to the earthquake in 2007. Physical construction of the building by the private sector is also accompanied by an assessment of thecompetency of teachers who teach at the school. Collecting data in this study is using interviews and questionnaires. The data were analyzed descriptively. The minimum basic competence profile of teacherswho assessed include: planning of teaching, mastery of materials and teaching methods, and thedevelopment of teaching materials, the ability to establish relationships with students, and the ability toestablish a relationship with the environment. Based on the research results, the basic competence profileprimary teachers Delegan-2 included in both categories for planning instruction, mastery of materials andmethods of learning, and the ability to establish relationships with students. However, for the developmentof teaching materials, and the ability to establish a relationship with the environment, in the categoryenough. Universitas Mercu Buana 2015-06-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3684 10.22441/jimb.v1i2.3684 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 2 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 245-249 2655-7274 2460-8424 10.22441/jimb.v1i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3684/1896 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/8152 2020-12-15T10:48:43Z jimb:ART driver

PENGARUH BUDAYA ORGANISASI DAN KEPEMIMPINAN TRANSFORMASIONAL TERHADAP KINERJA GURU (Studi Kasus Pada SMA Negeri 90 Jakarta) Suprapto, Suprapto Herminingsih, Anik Budaya organisasi, Kepemimpinan transformasional, Kinerja guru. Penelitian ini bertujuan menguji dan menganalisis pengaruh budaya organisasi dan kepemimpinan transformasional terhadap kinerja guru. Jenis penelitian ini adalah survey explanatory untuk menjelaskan hubungan kausal antar variabel penelitian dengan pengujian hipotesa. Populasi penelitian ini melibatkan guru  SMA Negeri 90 Jakarta tahun pelajaran 2015 / 2016 berjumlah  50 orang. Metode yang digunakan adalah regresi linear berganda dengan melakukan uji validitas, uji reliabilitas, uji asumsi klasik dan analisis regresi linear berganda. Hasil penelitian menunjukkan bahwa variabel budaya organisasi secara parsial berpengaruh positif dan signifikan terhadap kinerja guru sehingga penelitian ini menerima hipotesis (H1).  Kepemimpinan transformasional berpengaruh positif terhadap kinerja. Penelitian ini menerima hipotesis (H2) yang menyatakan bahwa gaya kepemimpinan berpengaruh positif terhadap kinerja guru. Selanjutnya, Hasil uji F dan uji koefisien determinasi menunjukkan bahwa variabel independent budaya organisasi dan kepemimpinan transformasional secara simultan berpengaruh positif dan signifikan terhadap kinerja guru SMAN 90 Jakarta. Penelitian ini menerima hipotesis (H3) yang menyatakan bahwa budaya organisasi dan kepemimpinan transformasional berpengaruh positif dan signifikan terhadap kinerja guru SMA Negeri 90 Jakarta. Universitas Mercu Buana 2020-04-22 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8152 10.22441/jimb.v6i1.8152 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 1 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 13 - 29 2655-7274 2460-8424 10.22441/jimb.v6i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8152/3352 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3499 2018-08-24T07:02:50Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15962 2022-08-02T07:18:30Z jimb:ART driver

An Analysis Of Communication Celebrity Endorsement On Brand Image Dewi, Inge Bunga Mira Anaway, Karina Amalia Poernomo, Marlinda Irwanti Jamalullail, Jamalullail Wandrial, Son The main objective of this study is to propose a conceptual model to assess whether persuasive messages can lead to acceptance in the form of information provided by Instagram social media opinion leaders, and, also, the extent to which messages on products and services affect brand image recommended by celebrity endorsement. Communication helps managers to do their jobs and responsibilities. Communication serves as the basis for planning. Celebrity endorsement are used as a common corporate communication strategy to build brand image. Advertisers believe that the use of celebrity endorsement affects advertising effectiveness as well as on purchase intention and repurchase. The study used a quantitative approach using 241 samples from clothing consumers using multiple linear regression processed with SPSS 25. The results of this study found that there was a significant and positive influence of celebrity endorsement on clothing companies brand image. Celebrity endorsement play an important role in improving clothing companies brand image with the endorsement method carried out by celebrity endorsement proven to be able to give a positive impression on the brand image in the eyes of consumers, especially on social media Instagram. Universitas Mercu Buana 2022-08-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15962 10.22441/jimb.v8i2.15962 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 2 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 218-226 2655-7274 2460-8424 10.22441/jimb.v8i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15962/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/20022 2023-12-02T02:57:17Z jimb:ART driver

Investigating The Role of Emotional Intelligence in The Relationship Between Adversity Quotient and Self Efficacy To Work Stress Aulia, Aulia Sofwan, Mochamad Apriadi, Intan Priyono, Priyono Soelton, Mochamad Adversity Quotient, Self Efficacy, Job Stress, Emotional Intelligence Human resources is very important for companies in managing, regulating, and empowering employees so that they can function productively to achieve company goals. Human resources in the company need to be managed professionally in order to realize a balance between the needs of employees and the demands and capabilities of the company's organization. Employees are placed according to their skills and abilities, high level of company work, high work motivation, high work participation, effective work communication, high work discipline, employee wages and salaries are determined fairly according to position, education, and responsibilities tall one. The purpose of this study was to analyze the role of Adversity Quotient and Self Efficacy on Job Stress mediated by Emotional Intelligence at PT. Tripuri Mitra Nobelindo. Using a saturated sample with a total of 50 employees, the analysis was carried out quantitatively with the method of collecting questionnaires. Structural Equation Model (SEM) was used as an analytical method and Smart – PLS was used as an analytical tool. The results of the study, Adversity Quotient has a significant negative effect on Job Stress, Self efficacy has a significant negative effect on Job Stress, Adversity Quotient has a significant positive effect on Emotional Intelligence, Self Efficacy has a significant positive effect on Emotional Intelligence, Emotional Intelligence has a significant negative effect on Job Stress, Adversity Quotient does not have a significant effect on Job Stress through Emotional Intelligence, and Self Efficacy has a significant negative effect on Job Stress through Emotional Intelligence. Universitas Mercu Buana 2023-08-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/20022 10.22441/jimb.v9i2.20022 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 2 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 218-238 2655-7274 2460-8424 10.22441/jimb.v9i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/20022/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5615 2019-05-07T05:59:51Z jimb:ART driver

PENGARUH STRATEGIC LOCATION DAN MARKETING COMMUNICATION TERHADAP KEPUTUSAN PEMBELIAN PERUMAHAN PURI MANSION Samudro, Amzad keputusan pembelian, marketing communication, strategic location. Penelitian ini bertujuan untuk mengetahui pengaruh strategic location dan marketing communication terhadap keputusan pembelian responden yang merupakan pemilik puri mansion perumahan. Penelitian ini bersifat deskriptif. Data primer dan data sekunder diperoleh. Data sekunder diperoleh dari berbagai sumber seperti jurnalis, buku dan data primer publikasi terkait lainnya yang diperoleh dengan membagikan koesioner kepada responden sasaran. Dengan menggunakan teknik convenience sampling, sampel total 100 responden diperoleh. Hasil penelitian ini menunjukkan tanggal dimana strategic location dan marketing communication berpengaruh positif terhadap keputusan pembelian. Kemudian strategic location dan marketing communication berpengaruh secara positif signifikan terhadap keputusan pembelian. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5615 10.22441/jimb.v4i3.5615 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 3 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 368 - 380 2655-7274 2460-8424 10.22441/jimb.v4i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5615/2555 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/10702 2021-07-31T15:44:54Z jimb:ART driver

Re-engineering and Technology Development on Reference Sample of Business Process (Case Study on Health Laboratory Service Company) Yuliana, Vinsia Santoso, Sugeng Business process, waste, factors that cause waste, business process re-engineering. In the health laboratory companies a good service quality is the main key that should be maintained. Poor service quality would have an impact in reducing customer trust and also would have an impact on company's incomes. One of issues which happened in health laboratory companies particularly in referral sample services is inefficient times when doing the existing work which causing longer of waiting times. This research intend to identified the waste, revealed the causative factors and done the business process re-engineering which contained in reference sample of business process in health laboratory companies. This type of research were included in quantitative research with a descriptive - exploratory methods. The Data collection and analysis using primary and secondary data with quantitative data analysis. The results showed that before the business process reengineering was done, a lead time and process time needed 825 minutes, but after the repairs has done through identified the waste and determining factors which causing waste by using the BPR method, then the lead time and process time were reduced until 370 minutes, which shown there has a significant decreased amounted to 450 minutes or 54%. Universitas Mercu Buana 2021-07-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10702 10.22441/jimb.v7i2.10702 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 2 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 212-222 2655-7274 2460-8424 10.22441/jimb.v7i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10702/4650 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3745 2018-09-05T04:18:38Z jimb:ART driver

PELAYANAN DAN PERSEPSI HARGA Kasmo, Arief Bowo Prayoga Santoso, Arif Budi Kualitas Pelayanan; Persepsi Harga; Kepuasan Konsumen; Usaha Jasa Wisata; Persaingan antar usaha biro perjalanan wisata memberikan dampak pada evaluasi peningkatan kepuasankonsumen pengguna biro perjalanan wisata sebagai upaya untuk mempertahankan dan mengembangkanusaha jasa wisata domestik. MY Permata Wisata merupakan usaha perjalanan wisata yang relative baru,didirikan pada tahun 2013 dan mengkhususkan pada wisata domestik dengan visi untuk lebih mengenalkanwisata Indonesia pada masyarakat luas. Pada penelitian ini bertujuan untuk mengetahui pengaruh kualitaspelayanan dan persepsi harga pada kepuasan konsumen MY Permata Travel. Populasi penelitian ini yaitupengguna jasa biro perjalanan MY Permata Travel dengan tujuan wisata domestik meliputi Bali, Dieng, GreenCanyon-Pangadaran, Bromo, Krakatau, Karimun Jawa, Sawarna dan Pulau Pari, dengan jumlah sampelsebanyak 83 responden. Sampel penelitian dengan metode purposive sampling dan untuk uji hipotesis dengan menggunakan uji t. Hasil dari penelitian ini menunjukkan bahwa terdapat pengaruh yang signifikanantara kualitas pelayanan dan persepsi harga dengan kepuasaan konsumen, namun walaupun demikiankontribusi kualitas pelayanan dan persepsi harga pada kepuasan konsumen biro perjalanan wisata MYPermata Wisata hanya 43,7%. Saran dari penelitian ini adalah pengelola usaha MY Permata sebaiknya selaintetap menjaga kualitas pelayanan jasa dan persepsi harga untuk mempertahankan kepuasan konsumennyajuga memperhatikan faktor lain yang belum diteliti pada penelitian ini seperti pilihan produk jasa yangditawarkan, citra perusahaan dan lainnya. Universitas Mercu Buana 2016-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3745 10.22441/jimb.v2i3.3745 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 3 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 738-750 2655-7274 2460-8424 10.22441/jimb.v2i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3745/1928 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3859 2018-09-10T03:00:23Z jimb:ART driver

PENGARUH KOMPETENSI GURU TERHADAP EFEKTIVITAS PEMBELAJARAN Hazami, Hazami Herminingsih, Anik kompetensi pedagogik; kompetensi kepribadian; kompetensi sosial; kompetensi profesional; Efectivitas Pembelajaran Penelitian ini bertujuan menguji dan menganalisa pengaruh Kompetensi Pedagogik,Kompetensi Kepribadian, Kompetensi Sosial dan Kompetensi Profesional terhadapEfektivitas Pembelajaran.di SMA Negeri 96 Jakarta. Desain penelitian yang di gunakanbersifat deskriptif berjenis riset eksplanatori dengan metode survey. Data di ambilmenggunakan kuesioner yang di berikan kepada 45 orang responden, dengan tehnikpengambilan sampel yang digunakan adalah jenis sensus. Metode analisis yang di gunakanadalah regresi Linear berganda. Hasil Penelitian menunjukkan bahwa Variabel kompetensi Pedagogik, Kompetensi Sosial, Kompetensi Profesional secara parsial berpengaruh positif dan signifikan terhadap Efectivitas Pembelajaran, sedangkan Variabel kompetesi Kepribadian secara parsial tidak berpengaruh signifikan Efectivitas Pembelajaran Secara simultan, ke empat variable bebas komptensi pedagogik, kompetensi kepribadan, kompetensi sosial, dan kompetensi profesional Guru berpengaruh positif dan signifikan terhadap Efectivitas Pembelajaran di SMA Negeri 96 Jakarta. Universitas Mercu Buana 2017-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3859 10.22441/jimb.v3i3.3859 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 3 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 364-384 2655-7274 2460-8424 10.22441/jimb.v3i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3859/2027 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/7259 2020-12-15T10:49:05Z jimb:ART driver

PENGARUH RASIO KEUANGAN DALAM MEMPREDIKSI PERTUMBUHAN LABA Suryani, Dwi Mujino, Mujino Rinofah, Risal current ratio, debt to equity ratio, total asset turnover, dan net profit margin, earnings growth This study aims to determine the effect of financial ratios consisting of current ratio, debt to equity ratio, total asset turnover, and net profit margin in predicting profit growth. This study took samples of the basic and chemical industry companies listed on the Indonesia Stock Exchange from 2013 to 2018. The sampling technique uses purposive sampling technique with samples used by 10 companies over a period of 6 years so that there are 60 samples in total. The results showed that the simultaneous current ratio, debt to equity ratio, total asset turnover, and net profit margin had a significant effect in predicting profit growth. Partially the debt to equity ratio and net profit margin have a significant positive effect in predicting profit growth. However, the current ratio does not have a significant negative effect in predicting earnings growth, while total asset turnover does not have a significant positive effect in predicting earnings growth. Universitas Mercu Buana 2020-07-27 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7259 10.22441/jimb.v6i2.7259 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 2 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 155 - 164 2655-7274 2460-8424 10.22441/jimb.v6i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7259/3594 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3536 2018-09-03T04:11:29Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3687 2018-09-03T03:15:44Z jimb:ART driver

FAKTOR- FAKTOR YANG MEMPENGARUHI STRUKTUR MODAL PADA BANK YANG TERDAFTAR DI BURSA EFEK INDONESIA PERIODE 2008-2010 Juniarti, Septiani Net Profit Margin (NPM); Current Ratio (CR); Degree Operating Leverage(DOL); Laba operasi; Capital Adequation Ratio (CAR); Non Performing Loan (NPL); Struktur Modal (DER) Penelitian ini bertujuan untuk mengetahui pengaruh variabel Net Profit Margin (NPM), Current Ratio (CR),Degree Operating Leverage(DOL), Laba operasi, Capital Adequation Ratio (CAR), Non Performing Loan (NPL)terhadap Struktur Modal ( DER ) pada bank yang terdaftar pada Bursa Efek Indonesia tahun 2008-2010.Penelitian ini menggunakan metode Purposive Sampling terhadap bank yang terdaftar di Bursa EfekIndonesia selama 3 tahun berturut-turut yaitu tahun 2008-2010. Data yang digunakan didalam penelitian ini adalah data sekunder yang diperoleh dari Pusat Referensi Pasar Modal (PRPM) di Bursa Efek Indonesia.Penelitian ini menggunakan Model Effect Tetap (MET) di dalam metode analisis, dan pengujian dilakukandengan menguji statistik secara parsial dan secara bersama- sama.Hasil analisis menunjukkan bahwa secara bersama- sama variabel independen berpengaruh signifikanterhadap variabel dependen, sedangkan jika dilihat hasil analisis secara parsial., variabel independent yangpaling memiliki pengaruh adalah variabel NPL (Non Performing Loan). Universitas Mercu Buana 2016-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3687 10.22441/jimb.v2i1.3687 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 1 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 423-437 2655-7274 2460-8424 10.22441/jimb.v2i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3687/1898 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3519 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/559 2018-08-25T04:29:54Z jimb:ART driver

PENGARUH CITRA MEREK, KEPERCAYAAN (TRUST) DAN KOMITMEN TERHADAP LOYALITAS NASABAH PADA PT. HENAN PUTIHRAI ASSET MANAGEMENT Maliyah, Siti This research discusses the influence of brand image, confidence (trust) and a commitment to customer loyalty at PT. Henan Putihrai Asset Management. Authors limit the scope of the problem only in Jl. Jenderal Sudirman, Jakarta. Data were obtained through questionnaires to 131 Responden.PT. Henan Putihrai Asset Management. Data collection methods used are convience sampling, whereas analytical tool used is structural equation model SEMAMOS 18. Results of hypothesis testing showed significant influence on customer loyalty commitment, but partially not affect the brand image segnifikan of trust, brand image segnifikan no effect on commitment, and trust segnifikan no effect on commitment. For further research it is advisable to do some research other than a company engaged in the investment manager. Keywords: brand image, confidence (trust), commitment, customer loyalty Universitas Mercu Buana 2016-05-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/559 10.22441/jimb.v1i1.559 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 1 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 9-21 2655-7274 2460-8424 10.22441/jimb.v1i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/559/490 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/27593 2024-08-19T04:18:16Z jimb:ART driver

Optimizing Business Performance Through Relationship Quality and Value Co-Creation Prasetya, Prita Relationship quality; Value co-creation; Performance; B2B Business; Manufacturing-Retailer Relationship The relationship between the concept of relationship marketing and performance is a major focus in the management and marketing literature. This research aims to explore and analyze how value co-creation and relationship quality contribute to improving performance in the context of the B2B industry. Using quantitative methods with partial least squares structural equation modeling (PLS-SEM), this study tests the hypotheses linking relationship quality, value creation, and performance. The data was obtained from a survey of 105 retailers (SEM PLS 4) to analyze the data collected from 105 retailers. Respondents consisted of managers and owners who have direct experience in customer relationship management. The analysis results show that relationship quality has a direct and positive influence on value co-creation and performance. In addition, value co-creation was also found to have a direct and positive influence on performance. Most importantly, this study reveals that value co-creation mediates the effect of relationship quality on performance. That relationship quality is an important foundation that is beneficial to the performance achieved through value co-creation between manufacturers and retailers. The theoretical contribution of this study is that it strengthens the understanding in the literature of how relationship quality and value co-creation are interrelated and jointly influence performance in a B2B context. Practically, the findings underscore the importance for firms to not only focus on building strong relationships but also actively engage in value co-creation activities to optimize business performance. Universitas Mercu Buana 2024-08-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/27593 10.22441/jimb.v10i2.27593 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 2 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 276-290 2655-7274 2460-8424 10.22441/jimb.v10i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/27593/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/27593/6540 Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/4403 2018-11-19T07:14:33Z jimb:ART driver

PENGARUH KOMPENSASI DAN KEPUASAN KERJA TERHADAP EMPLOYEE ENGAGEMENT YANG BERDAMPAK PADA TURNOVER Jurnal Manajemen Ilmiah Bisnis/Volume IV, No. 01, Maret 2018: 117-131 INTENTIONS Affini, Dinar Nur Surip, Ngadino kompensasi; kepuasan kerja; employee engagement; turnover intentions Mengelola sumber daya manusia dalam sebuah perusahaan semakin diakui sebagai pusat pentinguntuk pelaksanaan strategi perusahaan tersebut kedepan, sehingga perlunya konsistensiperusahaan dalam menjaga kepuasaan kerja karyawan dan perusahaan. Penelitian ini bertujuanmengetahui bagaimana pengaruh kompensasi dan kepuasan kerja terhadap employee engagementserta dampaknya terhadap turnover intentions pada PT. Bank XYZ, Tbk, berdasarkan fenomenafenomenayangterjadidiBankXYZ.Penelitianinimenggunakanpendekatandeskriptif.Teknikanalisissecara kuantitatif dengan menggunakan metode analisa jalur (Path Analysis) untukpengujian hipotesis dan juga dilakukan analisis antar dimensi. Data penelitian merupakan dataprimer yang dikumpulkan dengan menggunakan kuesioner yang diberikan kepada karyawan Kantor Pusat bank XYZ sebanyak 169 sampel yaitu yang tersebar pada5 lokasi kantor selama periode Mei 2015 – Juni 2015. Dari hasil penelitian ditemukan bahwa terdapat pengaruh langsung, pengaruh tidak langsung dan pengaruh gabungan antara kompensasi, kepuasan kerja, employee engagement dan turnover intentions. Universitas Mercu Buana 2018-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4403 10.22441/jimb.v4i1.4403 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 1 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 113-127 2655-7274 2460-8424 10.22441/jimb.v4i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4403/2171 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/11231 2021-03-31T18:37:14Z jimb:ART driver

INFLUENCE OF WORK DISCIPLINE AND WORK MOTIVATION ON EMPLOYEE PERFORMANCE AT XYZ KUNINGAN MSMEs, WEST JAVA Asri, Gessa Mertha Herwanto, Dene employee performance, human resources, work discipline, work motivation Human Resources (HR) is something that is very important in a company because it can affect whether or not a company is good. Small, Micro and Medium Enterprises (MSMEs) XYZ is a business unit engaged in the food sector, namely making tofu such as skin tofu, milk tofu, wet tofu, etc. This study aims to determine whether there is an influence between work motivation and work discipline on employee performance. The research method used is descriptive quantitative, namely discussing the company's problems with work discipline and work motivation on employee performance. This research was conducted by distributing questionnaires to 15 employees at MSMEs XYZ. Based on the research that has been done, from the results of the partial test (t test) that the Work Motivation variable (X2) has an effect on Employee Performance (Y) with a significant value of 0.048 <0.05 because the significant value of t count is smaller than t table. Universitas Mercu Buana Universitas Singaperbangsa Karawang 2021-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11231 10.22441/jimb.v7i1.11231 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 1 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 64-80 2655-7274 2460-8424 10.22441/jimb.v7i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11231/4360 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3544 2018-08-25T05:35:19Z jimb:ART driver

PENGARUH KUALITAS LAYANAN (SERVICE QUALITY) TERHADAP KEPUASAN MAHASISWA KELAS KARYAWAN FAKULTAS EKONOMI DAN BISNIS, UNIVERSITAS MERCU BUANA Parashakti, Ryani Dhyan Anggraini, Rini Yusnina, Yusnina Service Quality; Student’s Satisfaction The research aims to find out the influence of service quality consist of reliability,responsiveness, assurance, emphathy and tangibles on the students’ satisfaction inManagement Deparment of Economic and Business Faculty of Mercu Buana UniversityJakarta. This study is categorized into quantitative research with survey approach. Thetotal sample research are 158 respondents of 2.925 students populations which aredetermined through Solvin formula, while the technique of sampling uses Simple RandomSampling Methode. The research instrument testing uses validity test and reliability test.In the meantime, the data analysis technique uses multiple linear regression withhyphotesis. The results of the research shows that from the calculation of F test, fivedimensions of service quality influences simultanty on the students’ satisfaction inManagement Department of Economic and Business Faculty of Mercu Buana University,Jakarta (Y). From the calculation of t test is proven that partially, variable of tangibles(x1), reliability (x2), responsiveness (x3) and assurance (x4) have a significant influence todependent variable (Y), while the variable of empathy (x5) has no significant influence todependent variable (Y). From the calculation of the coefficient of determination (AdjustedR2) shows a value of 0,999 which means that the influence of the independent variable is99,9%, while the remaining 0,1% is influenced by other variables, beyond the fiveindependent variables. Universitas Mercu Buana 2018-08-24 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3544 10.22441/jimb.v3i1.3544 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 1 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 19-29 2655-7274 2460-8424 10.22441/jimb.v3i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3544/1878 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3850 2018-09-10T02:38:32Z jimb:ART driver

PERBEDAAN KINERJA KEUANGAN PERUSAHAAN PENGAKUISISI SETELAH MELAKUKAN MERGER DAN AKUISISI Biantoro, Agung Wahyudi merger; akuisisi; kinerja keuangan; Pengembangan perusahaan atau ekspansi dilakukan sebagai bagian dari strategi untukmemenangkan persaingan atau untuk bertahan ditengah persaingan. Merger dan akuisismenjadi salah satu cara yang digunakan oleh perusahaan untuk melakukan pengembanganusaha. Perusahaan yang melakukan merger dan akuisisi seringkali mengalami perubahan di dalam kegiatannya. Perubahan yang terjadi terutama dalam segi kinerja keuangan. Penelitian ini bertujuan mengetahui ada tidaknya perbedaan kinerja keuangan sebelum dan sesudah perusahaan melakukan kegiatan merger dan akuisisi. Desain penelitian adalah desain penelitian asosiatif guna mengetahui hubungan antara dua variabel atau lebih. Populasi dalam penelitian ini adalah seluruh perusahaan manufaktur yang melakukan merger dan akuisisi selama periode pengamatan. Sampel penelitian ditetapkan berdasarkan kriteria subsector industri semen dan pertambangan dengan masing-masing objek terdiri dari tiga perusahaan. Periode pengamatan selama tiga tahun sebelum dan tiga tahun sesudah merger dan akuisisi dilakukan. Hasil penelitian menunjukkan bahwa secara keseluruhan tidak terdapat perbedaan kinerja keuangan sebelum dan sesudah dilakukannya merger dan akuisisi ditunjukkan dengan nilai sig lebih besar dari 0.05.Sedangkan berdasarkan sub sector industri, terdapat perbedaan kinerja keuangan industrisemen dan pertambangan pada rasio ROA, TATO, dan NPM sesudah terjadinya mergerdan akuisisi. Universitas Mercu Buana 2018-09-10 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3850 10.22441/jimb.v3i2.3850 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 2 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 216-234 2655-7274 2460-8424 10.22441/jimb.v3i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3850/2018 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/589 2018-09-03T03:15:44Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3695 2018-09-03T03:56:10Z jimb:ART driver

PRILAKU HARGA KOMODITAS TIMAH DI PASAR BURSA KOMODITAS Munandar, Adis Imam Timah; Harga; Bursa Berjangka Komditas; ARIMA Penelitian ini bertujuan untuk mengkaji prilaku harga komoditas timah di pasar bursa komoditasberjangka. Secara khusus penelitian ini bertujuan untuk membuat model peramalan harga komoditastimah di pasar bursa komoditas yang saat ini berfluktuatif. Dengan adanya peramalan harga ini dapatmembantu pihak manajemen memutuskan dalam jual-beli komoditas timah. Metode yang digunakandalam penelitian ini adalah deskriptif analisis. Analisis yang digunakan dalam penelitian ini meliputi metode: Box-Jenkins (ARIMA) yang digunakan untuk membuat model peramalan. Hasil analisismenunjukkan model ARIMA (0,1,2) merupakan yang paling sesuai untuk peramalan harga timah duniadengan persamaan model Yt = 0,45 - 0,1991e . Data ramalan lima hari mendatang dibandingkan dengandata real menunjukkan hasil yang mirip. Model yang sesuai akan dapat mengetahui prilaku hargakomoditas timah dunia agar pengusaha timah dapat mengatur strategi yang sesuai dalam menghadapifluktuasi harga timah yang terjadi di dunia. Universitas Mercu Buana 2016-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3695 10.22441/jimb.v2i1.3695 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 1 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 549-557 2655-7274 2460-8424 10.22441/jimb.v2i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3695/1905 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/33400 2025-08-20T14:28:46Z jimb:ART driver

Improving Brand Awareness and Market Competitiveness in Homecare Services: Business Strategy Analysis of Care Your Self (CYS) Nanda, Yumas Gia Astuti, Novika Candra Uno, Indra Cahya homecare services; brand awareness; competitive strategy; healthcare marketing; Indonesia; AHP analysis The homecare healthcare industry in Indonesia is experiencing rapid growth due to the aging population, increasing prevalence of chronic diseases, and rising demand for personalized healthcare services. Despite this opportunity, many providers face challenges in building market visibility and competing in a fragmented and price-sensitive market. This paper analyzes the business strategy of Care Your Self (CYS), a comprehensive homecare nursing service provider, focusing on brand awareness and competitive positioning. Using a mixed-method approach and strategic analysis frameworks such as SWOT, PESTLE, Porter’s Five Forces, EFAS-IFAS, and AHP, this study proposes actionable strategies to improve CYS's brand strength and market competitiveness. Results show that a combination of digital marketing, service differentiation, IT infrastructure development, and strategic partnerships is essential for enhancing public awareness and driving sustainable business growth. The findings contribute to the broader understanding of healthcare marketing and strategic planning for emerging health service providers in developing economies. Universitas Mercu Buana 2025-07-28 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33400 10.22441/jimb.v11i2.33400 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 2 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 124-129 2655-7274 2460-8424 10.22441/jimb.v11i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33400/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3506 2018-08-24T07:02:51Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/25339 2024-03-31T13:46:17Z jimb:ART driver

The Influence of The Marketing Mix on Educational Decision-Making is a Fascinating Area of Study Sitorus, Budianto Realize, Realize Product, Price, Promotion, Place, People AbstractThis research employs a quantitative approach, utilizing a survey method as its chosen research design to investigate factors influencing students' decisions in choosing private junior high schools in Sekupang Subdistrict, Batam. Through the distribution of questionnaires to 159 students in the specified area, data is collected on various marketing mix components and their correlation with school choice decisions. The collected data undergoes rigorous multilinear regression analysis using the SPSS tool, employing statistical methods to test formulated research hypotheses and establish relationships between marketing mix variables and school choice decisions. The interpretation of results is presented, drawing meaningful conclusions and offering implications and recommendations for further development in the context of private junior high school selection. The final stage encompasses the meticulous creation of a research report adhering to scientific standards, comprehensively detailing the research stages, findings, data analysis, conclusions, and recommendations. This study contributes to a quantitative understanding of the multifaceted factors influencing students' decisions in the specified educational context. Universitas Mercu Buana 2024-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25339 10.22441/jimb.v10i1.25339 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 1 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 127-137 2655-7274 2460-8424 10.22441/jimb.v10i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/25339/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6934 2020-07-27T02:42:04Z jimb:ART driver

Peran Kepuasan, Loyalitas dan Kepercayaan Pelanggan Dalam Meningkatkan Word of Mouth: Sebuah Pembelajaran dari Lembaga Kursus dan Pelatihan (LKP) Surya, Ade Permata WOM, Kepuasan Pelanggan, Loyalitas pelanggan, Kepercayaan, Lembaga Pelatihan dan Kursus Penelitian ini bertujuan untuk menguji dan menganalisis pengaruh kepuasan pelanggan, loyalitas pelanggan dan kepercayaan terhadap word of mouth (WOM) di lembaga pelatihan dan kursus. Sebuah pelajaran dari Speak Project Academy, sebuah startup spesialis training untuk public speaking dan softskill lainnya di Indonesia dari perspektif konsumen. Penelitian ini dirancang dengan menggunakan eksperimen konklusif, dalam tipe kasual, dengan metode kuantitatif dan survei. Metode pengambilan sampel yang digunakan adalah probability sampling dan data dianalisis dengan SEM-PLS dengan WarpPLS 6.0. Data diambil dengan memberikan kuesioner online kepada responden melalui email. Responden adalah para alumni Speak Project. 128 kuesioner online dikumpulkan. Hasil penelitian menunjukkan bahwa kepuasan pelanggan berpengaruh positif signifikan terhadap loyalitas dan kepercayaan pelanggan, selanjutnya loyalitas dan kepercayaan pelanggan mempengaruhi WOM secara positif dan signifikan. Di sisi lain, kepuasan pelanggan tidak berpengaruh signifikan secara langsung terhadap WOM. Koefisien Adjusted R-squared WOM adalah 0,561 yang berarti 56% WOM dapat dibuat dengan kepuasan, loyalitas, dan kepercayaan pelanggan. Universitas Mercu Buana 2019-12-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6934 10.22441/jimb.v5i3.6934 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 3 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 180-191 2655-7274 2460-8424 10.22441/jimb.v5i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6934/2985 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/14047 2022-10-07T09:28:10Z jimb:ART driver

Improving Integrated Reporting Quality Through Islamic Corporate Governance Arinta, Yusvita Nena Ashari, M. Fatkhan Integrated Reporting; Islamic Corporate Governance; Integrated Reprting Quality Innovative and adaptive to face new business challenges by making the process of creating added value for the company. Integrated Reporting is a reflection of the efficiency and effectiveness of various types of corporate capital. The main focus of the implementation of integrated reporting is on transparency and optimizing stakeholder interests, namely in the field of corporate governance. This study aims to examine the effect of the implementation of the Islamic corporate governance mechanism on integrated reporting. The sampling in this study was purposive sampling with the results of 12 Islamic banks. Hypothesis testing using multiple regression analysis. The result of hypothesis testing is the characteristics of independent commissioners consisting of the number and frequency of audit committee meetings have a positive and significant effect on improving the quality of integrated reporting. characteristics of the audit committee consisting of the number of audit committees, audit committee education, and the frequency of audit committee meetings have a significant effect on increasing integrated reporting quality. sharia supervisory board consisting of the number, education and frequency of sharia supervisory board meetings have an effect on increasing integrated reporting quality, except for the variable number of sharia supervisory boards Universitas Mercu Buana IAIN Salatiga 2022-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14047 10.22441/jimb.v8i1.14047 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 1 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 96-109 2655-7274 2460-8424 10.22441/jimb.v8i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14047/pdf_1 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/14047/2707 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/14047/2708 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/14047/2709 Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/19031 2023-11-30T15:11:24Z jimb:ART driver

Turnover Intention in Healthcare Workers: An Investigation of Work Environment, Employee Performance, And Work Satisfaction Us Mediating Role Widyanty, Winda Prasetya, Prita Turnover Intention, Work Environment, Employee Performance, Work Satisfaction, Healthcare Workers Every company, including in the health industry, needs quality human resources (employees) in carrying out its operational activities. Employees are the organization's main asset and have a strategic role in the organization, namely as thinkers, planners, and controllers of organizational activities. We investigated the turnover rate of healthcare workers in terms of the work environment, employee performance, and job satisfaction as a mediating role. We tested our hypothesis using SEM/PLS on 75 respondents who worked in healthcare companies and found that the work environment, employee performance, and job satisfaction influence the turnover intention of employees who work in the health sector. Universitas Mercu Buana 2023-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/19031 10.22441/jimb.v9i1.19031 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 1 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 101-116 2655-7274 2460-8424 10.22441/jimb.v9i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/19031/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/36499 2026-04-04T08:45:13Z jimb:ART driver

The Role of Intellectual Capital and Knowledge Management in Enhancing FMCG Firm Performance Maharsyah, Aburizal Firm Performance, FMCG, Intellectual Capital, Knowledge Management, PLS-SEM Researchaims:ThisstudyaimstoanalyzetheroleofIntellectualCapital(IC) and Knowledge Management (KM) in influencing Firm Performance (FP) in companies within the Fast-Moving Consumer Goods (FMCG) sector.Design/Methodology/Approach: A quantitative approach was employed using thePartialLeastSquaresStructuralEquationModeling(PLS-SEM)method.Data werecollectedthroughquestionnairesdistributedto104respondentsacrossvarious job levels.Research findings: The results indicate that both IC and KM have a positive and significant impact on FP.Furthermore, KM was foundto partially mediate therelationship between IC and FP, implying that a firm’s success is not only determinedbyintellectualcapitalbutalsobyitsabilitytomanageandutilizeknowledge effectively.Theoretical Contribution/Originality: This study contributes to the developmentofICandKMliteraturebyhighlightingthemediatingroleofKMinenhancing firm performance, particularly in the FMCG sector.Practitioners/Policy Implications: The findings provide practical insights for managersindesigningandimplementingknowledge-basedstrategiesthatintegrate IC and KM to strengthen firm performance and build sustainable competitive advantage in dynamic markets.ResearchLimitations/Implications:Thestudyislimitedbyitssamplesizeand focus on the FMCG sector. Future research may expand to other industries and employ longitudinal data to capture performance dynamics over time. Universitas Mercu Buana 2026-04-04 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/36499 10.22441/jimb.v12i1.36499 Jurnal Ilmiah Manajemen dan Bisnis; Vol 12, No 1 (2026): Jurnal Ilmiah Manajemen dan Bisnis; 138-155 2655-7274 2460-8424 10.22441/jimb.v12i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/36499/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/36499/9198 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/36499/9199 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/36499/9201 Copyright (c) 2026 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3710 2018-09-03T06:58:47Z jimb:ART driver

DAMPAK INSENTIF PAJAK PERUMAHAN TERHADAP POTENSI PENERIMAAN PAJAK NEGARA DAN PENINGKATAN PENDAPATAN MASYARAKAT: KASUS PROVINSI SULAWESI SELATAN Irawan, Towaf Totok Backlog; Gross Input; Primary Input; Intermediate Input Until now the government and private sector have not been able to address the backlogof 13.5 million housing units for ownership status and 7.6 million units for residentialstatus. The high price of land has led to the high price of the house, so that lowincomecommunities (MBR) is not able to reach out to make a home purchase. In addition to thehigh price of land, tax factors also contribute to the high price of the house. Thegovernment plans to issue a policy for the provision of tax incentives, ie abolish VAT onhomeforming material transaction. This policy is expected to house prices becomecheaper, so the demand for housing increases, and encourage the relevant sectors tointensify its role in the construction of houses. It is expected to replace the lost taxpotential and increase incomes. Analysis of the impact of tax incentives housing topotential state revenue and an increase in people's income, especially in South Sulawesiprovince is using the table IO because in addition to looking at the role each sector canalso see the impact on taxes (income tax 21 Pph 25Pph, VAT), and incomes (wage).Althoughintheshorttermimpactisstillsmall,butveryrewardinginthelongrun. Universitas Mercu Buana 2016-07-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3710 10.22441/jimb.v2i2.3710 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 2 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 683-694 2655-7274 2460-8424 10.22441/jimb.v2i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3710/1914 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/571 2018-09-03T02:57:19Z jimb:ART driver

PENGARUH KEMANDIRIAN DAERAH, INVESTASI PEMERINTAH, ANGKATAN KERJA DAN PENDAPATAN PERKAPITA TERHADAP PERTUMBUHAN EKONOMI DAERAH DI 33 PROFINSI TAHUN 2008 – 2013 Nurhayati, Mafizatun This study aimed to analyze the influence of fiscal independence, government investment, labor force and income per capita to economic growth regions in 33 provinces in 2008-2013. Methods of data analysis using multiple linear regression analysis. The results showed that the positive effect on the fiscal autonomy of regional economic growth. Local government investment positive effect on regional economic growth. Regional per capita income does not affect the economic growth of the region. The labor force does not affect the economic growth of the region.  Keywords: economic growth, fiscal independence, the government investment, per capita income, labor force. Universitas Mercu Buana 2016-05-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/571 10.22441/jimb.v1i3.571 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 3 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 280-295 2655-7274 2460-8424 10.22441/jimb.v1i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/571/500 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/32178 2025-04-10T02:03:31Z jimb:ART driver

The Effect Of Perceived Organizational Support And Compensation On Turnover Intention With Job Satisfaction As A Mediating Variable (Study on Gen Z Employees at PT XYZ) Siti Fatimah, Dyah Ayu Kasmawati, Yuni perceived organizational support; compensation; turnover intention; job satisfaction In today's work world, generation Z has the largest population compared to previous generations. Generation Z tends to pursue what they want so they often change jobs. Therefore, companies need to manage so that Gen Z employees do not have the desire to leave the company. Therefore, this study aims to analyze the Influence of Perceived Organizational Support and compensation on turnover intention with job satisfaction as a mediating variable. The study was conducted at PT. XYZ with a sample of 180 Gen Z employees. The sampling technique was probability sampling, while data collection used a questionnaire and data analysis techniques used SEM (Structural Equation Model) with the SmartPLS (Partial Least Square) approach. The results showed that perceived organizational support had a negative and significant effect on turnover intention. Compensation had a negative and significant effect on turnover intention. Job satisfaction had a negative and significant effect on turnover intention. Perceived organizational support and compensation had a positive and significant effect on job satisfaction. The role of job satisfaction as a mediator of the influence of perceived organizational support on turnover intention was proven to have a negative and significant effect. Likewise, job satisfaction was proven to mediate the influence of compensation on turnover intention, which was proven to have a negative and significant effect. Universitas Mercu Buana 2025-04-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32178 10.22441/jimb.v11i1.32178 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 1 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 28-41 2655-7274 2460-8424 10.22441/jimb.v11i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32178/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/18473 2023-12-07T03:09:20Z jimb:ART driver

The Influence of Discipline, Knowledge Management and Competence on The Performance of Outsourcing Employees Sabtu, Sulvia Tanjung, Hendri Ramly, Amir Teungku competence, discipline, knowledge management, performance of employees Performance management is management about creating relationships and ensuring effective communication between employees and their superiors. This study aims to analyze the influence of discipline, knowledge management and competence on the performance of outsourced employees at Plasa Telkom Bogor Bogor Regional 2. This research uses quantitative research with a descriptive approach. The sampling method used in this study was simple random sampling. The number of samples to be used in this study were 30 outsourced employees. The results showed that all variables had a significant effect on variable Y. The work discipline variable (X1) had a significant effect on employee performance because the results of the t significance test showed that the sig value of X1 was 0.036, this shows a significance value of less than 0.05. The Knowledge Management variable (X2) has a significant effect on Employee Performance (Y), this can be seen from the t significance test which shows the sig value of X2 is 0.035 (smaller than 0.05). Competency variable (X3) has a significant effect on employee performance (Y), this can be seen from the t significance test which shows the sig value of X3 is 0.015 (smaller than 0.05). Universitas Mercu Buana 2023-12-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/18473 10.22441/jimb.v9i3.18473 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 3 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 406-415 2655-7274 2460-8424 10.22441/jimb.v9i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/18473/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/18473/3951 Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6835 2019-09-05T10:07:57Z jimb:ART driver

Model Perilaku Pembelian Online Melalui Market Place Bukalapak Dilihat Dari Perspektif Persepsi Harga, Kualitas Pelayanan Dan Komunikasi Pemasaran Abdullah, Muhamad Al Faruq e-commerce, persepsi harga, kualitas pelayanan, komunikasi pemasaran, keputusan pembelian online. Penelitian ini bertujuan untuk membahas pengaruh keputusan pembelian secara online di marketplace. Objek penelitian adalah penjual yang mempunyai reputasi baik dan transaksi siginifikan dalam berjualan di e-commerce Bukalapak. Variabel independen yang didapatkan dari hasil survei pendahuluan kepada pembeli adalah persepsi harga, kualitas pelayanan, dan komunikasi pemasaran. Penelitian ini menggunakan teknik analisis data SEM dan pengolahan data menggunakan PLS.Populasinya adalah pelanggan e-commerce bukalapak yang berbelanja di toko Farqi Cellular, dengan sampel sekitar 162 responden. Hasil pengujian data dengan menggunakan software SmartPLS 3.0 didapatkan didapatkan persepsi harga mempunyai hubungan positif dan berpengaruh tidak signifikan,kualitas pelayanan dan komunikasi pemasaran mempunyai hubungan positif dan berpengaruh signifikan terhadap keputusan pembelian online. Dengan nilai R-square (R2) = 0.757 menunjukan bahwa kemampuan variabel independen (persepsi harga, kualitas pelayanan, komunikasi pemasaran) dalam menerangkan varians variabel dependen (keputusan pembelian online) sebesar 75,7%. Sedangkan 24.3% sisanya dijelaskan oleh faktor lain di luar model. Universitas Mercu Buana 2019-09-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6835 10.22441/jimb.v5i2.6835 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 2 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 204 - 217 2655-7274 2460-8424 10.22441/jimb.v5i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6835/2875 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/13027 2021-11-30T15:43:04Z jimb:ART driver

Human Resource Management In A Coffee Beverage Sme To Gain Competitive Advantage In Indonesia Romario, Robertus Prasetyaningtyas, Sekar Wulan Maharani, Anita coffee, food and beverages, human resource management, millennials, SMEs As a developing country, SMEs play an important role in Indonesia’s economy development. The prevalence of food and beverages SMEs in Indonesia is on the rise and on a tight competition, specifically coffee business. Inevitably, for the last couple of years, the number of new SMEs focusing on coffee beverage business is on the rise. Gaining a competitive advantage is essential for SMEs to achieve sustainability and profitability. There has been a dearth of studies on researching the importance of strategic human resource management to gain competitive advantage specifically for SMEs. Thus, this study aims to fill the gap in the literature on the topic and aims to assist entrepreneurs and SME founders in gaining competitive advantage through strategic human resource management. This study explores Kopi Soe, one of the most successful and leading coffee beverage SME in Indonesia on how Kopi Soe has been strategically manage its human resource to gain competitive advantage among its competitors. This study utilizes in-depth interview to collect data as qualitative method with Kopi Soe’s founders and employees to capture the human resource experience and how effective human resource management has been successfully putting them as the top coffee beverage SME in Indonesia in two years. The study found that Kopi Soe’s high involvement of human resource management positively increases competitive advantage through both innovative performance and entrepreneurial performance. Moreover, since most of the employees are millennials, this study also includes managerial implications on how to manage millennials in SMEs. Universitas Mercu Buana 2021-11-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13027 10.22441/jimb.v7i3.13027 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 3 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 362-371 2655-7274 2460-8424 10.22441/jimb.v7i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13027/4943 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/33693 2025-12-04T03:24:26Z jimb:ART driver

Social Media and Direct Selling of Menara Kanaya Apartment by Perumda Pembangunan Sarana Jaya Daerah Khusus Jakarta Putri, Poppy Pertiwi Widjayanti, Arifiani Wibowo, Eddy Kusponco Indonesia's property companies have grown rapidly in recent years. The strategy includes social media marketing and direct sales to generate public buying interest, as used by Perumda Pembangunan Sarana Jaya, owned by Daerah Khusus Jakarta Local Government. This research aims to analyse the influence of social media marketing and direct selling on the purchase interest of Menara Kanaya Perumda Pembangunan Sarana Jaya, Jakarta. The study is based on a survey of 120 respondents, using a quantitative methodology. The results indicate that social media marketing and direct selling have a positive and significant influence on the purchase intention of Menara Kanaya Perumda Pembangunan Sarana Jaya. Social media marketing has a positive and significant influence of 57.7% on purchase interest, direct selling has a positive and significant influence of 47.1% on purchase interest, and simultaneously, social media marketing and direct selling have a positive and significant influence of 63.3% on purchase interest. The remaining 36.7% is determined by other factors not included in this study. Universitas Mercu Buana 2025-12-04 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33693 10.22441/jimb.v11i3.33693 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 3 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 369-379 2655-7274 2460-8424 10.22441/jimb.v11i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33693/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3849 2018-09-10T02:38:32Z jimb:ART driver

PENGARUH HARGA DAN LOKASI TERHADAP KEPUTUSAN PEMBELIAN (Studi Kasus pada Perumahan Ciujung River Park Serang, Banten) Puspa, Rani Permana, Angrian Nuryanti, Sesiyana Harga; Lokasi; Keputusan Pembelian; Variabel dalam penelitian ini adalah Price (X1), Location (X2) dan Purchase Decision(Y). Tujuan dari penelitian ini adalah untuk mengetahui pengaruh harga keputusanpembelian, lokasi pengambilan keputusan, pengaruh harga dan lokasi keputusanpembelian pada Ciujung River Park Residence. Penelitian ini menggunakan alatkuesioner kepada 55 responden. Peneliti menggunakan alat bantu, bernama SPSS untukmendapatkan hasil datanya. Peneliti menggunakannya untuk mendapatkan hasilvaliditas, reliabilitas, asumsi klasik, regresi sederhana, regresi berganda, korelasi, dan ujihipotesis. Hasil penelitian menunjukkan bahwa variabel (harga) berpengaruh terhadap keputusan pembelian, variabel kedua (lokasi) berpengaruh terhadap keputusan pembelian, dan hasil terakhir menunjukkan bahwa harga dan lokasi berpengaruh terhadap keputusan pembelian di Ciujung River Park Residence. Universitas Mercu Buana 2018-09-10 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3849 10.22441/jimb.v3i2.3849 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 2 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 205-215 2655-7274 2460-8424 10.22441/jimb.v3i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3849/2017 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/5938 2019-07-05T15:33:14Z jimb:ART driver

PERSEPSI WISATAWAN TERHADAP OBYEK WISATA PANTAI ANYER DI PROVINSI BANTEN Sugiwa, Iwan perception of tourists, Anyer Beach, Banten Province. Tourism in Banten Province becomes one of the original source of income, where Banten is famous for its many beaches and religious tourism destinations. Anyer Beach is one of the famous beach attractions in Banten Province. Tourists who will visit a tourist attraction will collect information about the location to be addressed, that's when awakened an expectation and perception by potential tourists about a tourist attraction. Information gathered by tourists will help the traveler in creating a negative and positive perception. Expectations and perceptions built by tourists based on the information collected are very important in helping managers of tourism to improve the quality of tourism. Tourists who have visited a tourist attraction will compare the information obtained with the actual conditions in the location of the object. Conformity between expectations and the perception of tourists while visiting a tourist attraction will build a positive perception of a tourist attraction. Universitas Mercu Buana 2018-11-14 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5938 10.22441/jimb.v4i2.5938 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 2 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 240-247 2655-7274 2460-8424 10.22441/jimb.v4i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5938/2614 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/10095 2020-12-15T10:40:37Z jimb:ART driver

PENGARUH ELECTRONIC WORD OF MOUTH, PROMOSI DAN KUALITAS PELAYANAN TERHADAP MINAT BERKUNJUNG GENERASI Z PADA DESTINASI WISATA HALAL PROVINSI JAWA BARAT Hanafiah, Ali Wibowo, Mas Wahyu Damayanti, Fitria E-WoM, Service Quality, Promotion, Halal Tourism, West Java. This study aims to examine the visiting intention of Generation Z to West Java as a halal tourism. West Java has the potential to become the leading halal tourism in Indonesia. West Java also has a crucial role in the development of the Sharia economy, considering that 46.5 million people in this country live in this area. This province also has a wealth of attractive artistic treats, a fairly thick culture, and the potential for natural resources (geographical factors) which are considered to be the selling point as a tourist destination. There are three variables that will be tested in this study to predict the visiting intention, namely Electronic Word of Mouth, Promotion and Service Quality. The questionnaire was distributed to 170 generation Z respondents and the data were processed using SmartPLS version 3.2.9. Electronic Word of Mouth, Promotion, and Service Quality have a positive and significant impact on generation Z's interest in visiting West Java as a halal tourist destination. West Java has a destination facility that offers open space, and facilitates generation Z to take selfies with a unique background. All these facilities are provided to accommodate the needs of Muslims to carry out their prayers. Universitas Mercu Buana 2020-12-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10095 10.22441/jimb.v6i3.10095 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 3 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 347 - 364 2655-7274 2460-8424 10.22441/jimb.v6i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10095/3998 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/1763 2017-09-28T04:26:49Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/561 2018-08-25T04:29:54Z jimb:ART driver

PENGARUH KOMUNIKASI ORGANISASI DAN LINGKUNGAN KERJA TERHADAP KINERJA KARYAWAN TETAP PADA PT. MAH SING INDONESIA Vesmagita, Shinta In achieving its objectives, PT. Mah Sing Indonesia should consider factors that can affect the performance of the employee. Among them are communication and work environment. Conditions of work environment and communication  greatly affect the performance of an employee. The research is aimed to know: 1) the effect of organization communication influences on permanent employee's performance, 2) the effect of working environment influences on permanent employee's performance, and 3) together with organization communication and work environment influence on permanent employee's performance. The population in this study was the total number of permanent employee of PT. Mah Sing Indonesia. Of this population will be drawn sample used in this study as respondents. Sampling technique in this study using convenience purposive sampling. By using Slovin formula it can be seen the number of sample. The method of analysis used by the authors is the Multiple Linear Regression Analysis, the t-test, and F-test.Keywords: Communication, Work Environment and Employee Performance Universitas Mercu Buana 2016-05-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/561 10.22441/jimb.v1i1.561 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 1 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 29-40 2655-7274 2460-8424 10.22441/jimb.v1i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/561/492 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/27799 2024-12-11T05:53:31Z jimb:ART driver

The Role of Employee Engagement in Mediating Organizational Culture on Employee Performance Qomari, Nurul Yuliantini, Tine Organizational; Culture; Employee Engagement; Employee Performance The aim of this research is to explore the impact of organizational culture on employee engagement, the impact of organizational culture on employee performance, the impact of employee engagement on employee performance, and the impact of employee engagement on organizational culture. The study utilized a causal research design that aligns with its objectives. The research sample consisted of 115 employees. The data analysis technique employed is SEM PLS (Structural Equation Modelling with Partial Least Squares). The results of the analysis show the impact of organizational culture on employee engagement. Organizational culture also has an impact on employee performance. Employee engagement also affects employee performance. In addition, employee engagement serves as a link between organizational culture and worker performance. These results underscore the significance of corporate culture in improving employee involvement and productivity. A robust and optimistic organizational culture leads to higher employee engagement and better performance. Employee engagement plays a crucial role in linking organizational culture with employee performance. This means that a good organizational culture can directly improve employee performance, as well as through increased employee engagement. Therefore, organizations aiming to improve employee performance should focus on developing a supportive and empowering organizational culture while promoting higher levels of engagement among employees. Universitas Mercu Buana 2024-12-04 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/27799 10.22441/jimb.v10i3.27799 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 3 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 327-336 2655-7274 2460-8424 10.22441/jimb.v10i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/27799/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/7209 2020-12-15T10:48:43Z jimb:ART driver

Pengaruh Kepemilikan Manajerial, Kepemilikan Institusional, Ukuran Perusahaan, Profitabilitas dan Leverage terhadap Nilai Perusahaan Aryanto, Fajar Ahmad Mujino, Mujino Rinofah, Risal Managerial Ownership, Institusional Ownership, Firm Size, Profitability, Leverage, Firm Value This research is proposed to find the influence of managerial ownership, institutional ownership, firm size, profitability and leverage on firm value in manufacturing companies in the consumer goods industry sector in the Indonesian stock market. This research used a quantitative approach. The population of the company in this study is the consumer goods industry sector in the Indonesian stock market in 2014-2018. The technique used to take samples uses purposive sampling. Data analysis techniques used multiple linear regression, partial test, simultaneous test and coefficient of determination. Universitas Mercu Buana 2020-04-22 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7209 10.22441/jimb.v6i1.7209 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 1 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 86 - 94 2655-7274 2460-8424 10.22441/jimb.v6i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/7209/3357 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/17049 2022-12-15T10:40:39Z jimb:ART driver

The Effect of Transformational Leadership Towards Work Engagement: The Variable Meaning Of Work as a Mediation at the Secretariat Region of East Java Province Yulianti, Praptini Permatasari, Dita Ayu transformational leadership;work engagement;meaning of work This study aims to see the effect of transformational leadership on work engagement with the meaning of work as a mediating variable at the Regional Secretariat of East Java Province. The population in this study were all employees with civil servant status in the existing bureaus at the Regional Secretariat of East Java Province, a total of 300 people. Sampling in this study used Slovin’s formula therefore the results obtained were 81 people. The measurement technique uses SEM-PLS ( Structural Equation Modelling-Partial Least Square on the software Smart PLS. The results of this study indicate that transformational leadership has a positive effect but not a significant effect on work engagement and the meaning of work can mediate the relationship between transformational leadership and work engagements. The mediation behavior finding in this meaning of work is full mediation, which means the independent variable is not able to significantly influence the dependent variable without going through the mediator variable, transformational leadership is unable to significantly influence the work engagements. Variable mediating behavior meaning of work strengthen influence transformational leadership to work engagement. Universitas Mercu Buana - 2022-12-15 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/17049 10.22441/jimb.v8i3.17049 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 3 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 277-292 2655-7274 2460-8424 10.22441/jimb.v8i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/17049/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/21573 2023-12-16T07:14:45Z jimb:ART driver

Effect of PNBP Policy on The financial Performance of Cellular Mobile Network Operators Ronny, Ronny Djamaluddin, Sartika Digital transformation is one of the programs initiated by the Government, which in practice requires the support of healthy mobile network operators through financial performance indicators, to fulfill the development of telecommunications infrastructure in all regions. Mobile network operators require significant capital to provide telecommunications infrastructure, including payment of Non-Tax State Revenue (PNBP) to the government every year, which continues to increase due to frequency allocation and telecommunications activities. The aim of this research is to measure the estimated influence of PNBP policy on the financial performance of mobile network operators in Indonesia, while considering several other control variables such as investment costs (CAPEX), number of subscribers, liabilities, number of base transceiver stations (BTS), and number of mobile network operators. This research uses panel data regression with a fixed effect model approach, covering four mobile network operators from 2010 to 2022. The results show that PNBP, sourced from the obligation to pay Spectrum Frequency Usage Fee, has a significant negative impact on financial performance. These findings are also consistent with the research conducted by Katz and Jung (2023) Universitas Mercu Buana 2023-12-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/21573 10.22441/jimb.v9i3.21573 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 3 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 292-306 2655-7274 2460-8424 10.22441/jimb.v9i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/21573/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5622 2019-12-12T10:28:12Z jimb:ART driver

STRATEGI PEMASARAN MELALUI IDENTIFIKASI FAKTOR PENTING YANG MEMPENGARUHI KONSUMEN MEMBELI MOBIL GREAT NEW XENIA DI WILAYAH JAKARTA SELATAN Soecahyadi, Soecahyadi Sari, Alvita Analisa Faktor, Great New Xenia, Strategi Pemasaran Kondisi pasar otomotif yang bergejolak tidak menjadi kendala yang berarti untuk penjualan multi purposes vehicles (MPV) yang di bundel dengan harga lebih rendah.PT. Daihatsu Astra Motor Daihatsu memperkenalkan produk terbaru mereka Great New Xenia termasuk mobil kelas low dan mid-end. Tujuan dari penelitian ini adalah mendapatkan faktor penting yang mempengaruhi konsumen dalam keputusan membeli mobil Daihatsu Great New Xenia, serta menentukan strategi pemasaran yang tepat dalam rangka meningkatkan penjualan. Faktor penting yang menjadi minat konsumen dalam membeli mobil Daihatsu Great New Xenia adalah dinamakan faktor Features yang terdiri atas mobil yang memiliki fitur-fitur yang lengkap, desain keseluruhan sangat menarik, kemudahan dalam mengoperasikan kendaraan baik yang manual maupun yang matic serta kemudahan metode atau cara pembayaran yang ditawarkan dealer kepada para calon pembeli.Strategi pemasaran yang perlu dilakukan oleh PT. Astra Daihatsu Motor, Tbk dalam rangka meningkatkan penjualan adalah dengan Melakukan berbagai kegiatan promosi yang mengedepankan Features kendaraan. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5622 10.22441/jimb.v5i1.5622 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 1 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 14 - 28 2655-7274 2460-8424 10.22441/jimb.v5i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5622/2561 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/11929 2021-07-30T16:25:49Z jimb:ART driver

THE EFFECT OF EXTRINSIC, INTRINSIC REWARDS AND WORK FLEXIBILITY ON JOB SATISFACTION FOR MILLENNILAS GENERATION (CASE STUDY ON PROPERTY AGENT IN SURABAYA) Lisa, Crysilia Yulianti, Praptini Extrinsic Rewards, Intrinsic Rewards, Work Flexibility, Job Satisfaction, Millennials Generation. This study aims to determine the effect of extrinsic, intrinsic rewards and work flexibility of  job satisfaction for millennial generations especially work as a property agents. Types of research used in this study is a quantitative and research methods are used methods of explanation. Samples taken as many as 50 property agents by using purposive sampling. Analysis techniques used are descriptive statistics and multiple linear regression analysis. The Result of this study indicate  intrinsic rewards and work flexibility has positive and significant effect on job satisfaction through millennials generation  work as a agent property rather that extrinsic reward. Universitas Mercu Buana 2021-07-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11929 10.22441/jimb.v7i2.11929 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 2 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 263-279 2655-7274 2460-8424 10.22441/jimb.v7i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11929/4655 https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/11929/2107 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/33618 2025-12-04T03:24:26Z jimb:ART driver

The Influence of Tourism Experience and Online Reviews on Revisit Intention (A Study on the Tourism Business of Green Canyon Pangandaran) Octavia, Fitriani Sukoco, Iwan Kurniawati, Linda Tourism Experience; Online Reviews; Revisit Intention; Green Canyon Pangandaran Tourism destination marketing strategies not only focus on creating experiences for tourists, but also need to pay attention to public perception on digital platforms through online reviews. This study aims to determine the effect of tourism experience and online reviews on revisit intention at the Green Canyon tourism business in Pangandaran Regency, West Java. This study uses quantitative methodology and uses a questionnaire as a tool to collect data from 150 respondents. The target population of this study consists of tourists who have visited Green Canyon Pangandaran at least once in the last three years (2023-2025) and have seen or given online reviews related to Green Canyon Pangandaran tourism on Google Maps, Social Media, and other platforms. Data were analyzed using multiple linear regression. The results showed that tourism experience and online reviews simultaneously have a positive and significant influence on the intention to revisit the Green Canyon Pangandaran tourism business. This research enriches the tourism behavior literature and provides insights for tourism managers to develop marketing strategies that focus on improving the quality of tourism experiences and managing online reviews to strengthen tourists' revisit intentions. Universitas Mercu Buana 2025-11-29 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33618 10.22441/jimb.v11i3.33618 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 3 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 254-264 2655-7274 2460-8424 10.22441/jimb.v11i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33618/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/33618/8379 Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3832 2018-09-08T01:21:29Z jimb:ART driver

EVALUASI SISTEM ANTRIAN INSTALASI FARMASI RAWAT JALAN DALAM MENENTUKAN JUMLAH ASISTEN APOTEKER OPTIMAL PADA INSTALASI FARMASI RAWAT JALAN SILOAM HOSPITALS KEBON JERUK Maheswari, Hesti Himawan, Sigit antrian; optimalisasi; pelayanan; pelayanan farmasi; Penelitian ini bertujuan untuk mengevaluasi optimalisasi pelayanan farmasi pada Instalasi FarmasiRawat Jalan Siloam Hospitals Kebon Jeruk dengan pendekatan queuing theory dalam rangka meningkatkankecepatan pelayanan. Populasi dalam penelitian ini adalah pelanggan yang datang dan masuk dalam sistemantrian pada Instalasi Farmasi Rawat Jalan Siloam Hospitals Kebon Jeruk, dan pemberi layanan (AsistenApoteker). Sampel dalam penelitian ini adalah semua pelanggan yang datang mengantri atau masuk dalamsistem antrian pada periode penelitian selama 6 hari kerja. Teknik pengumpulan data yang digunakan adalahsecara observasi. Metode analisis data dilakukan dengan menggunakan uji Goodness Of fit untuk mengetahuiapakah jumlah kedatangan pelanggan berdistribusi Poisson. Hasil penelitian ini menunjukkan bahwa pola kedatangan pelanggan mengikuti pola distribusi poisson. Pola pelayanan pelanggan mengikuti distribusi exponential. Dari perhitungan yang dilakukan denganmenggunakan tambahan 2 orang asisten apoteker untuk mendapatkan waktu yang optimal sesuai harapanpelanggan. Universitas Mercu Buana 2016-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3832 10.22441/jimb.v2i3.3832 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 3 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 819-826 2655-7274 2460-8424 10.22441/jimb.v2i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3832/2005 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3864 2018-09-10T03:09:23Z jimb:ART driver

PENGARUH PERENCANAAN KARIR, PENGEMBANGAN KARIR KARYAWAN, DAN KOMPENSASI TERHADAP KINERJA KARYAWAN PADA JAMBULUWUK PUNCAK RESORT Sugiharjo, R. Joko Rustinah, Rustinah perencanaan karir; pengembangan karir; kompensasi; kinerja karyawan; Penelitian ini untuk mengetahui pengaruh perencanaan karir, pengembangan karir, dankompensasi terhadap kinerja karyawan Jambuluwuk Puncak Resort. Responden dalampenelitian ini sebanyak 117 responden karyawan tetap dan kontrak dengan menggunakanpendekatan deskriptif kuantitatif. Karena itu, analisis data yang digunakan adalah analisisstatistik dalam bentuk uji regresi linier berganda. Hasil penelitian ini menunjukan bahwasecara parsial variabel perencanaan karir, pengembangan karir, dan kompensasiberpengaruh positif terhadap kinerja karyawan Jambuluwuk Puncak Resort. Hal inidibuktikan dari hasil uji parsial (uji T) juga menunjukan nilai signifikansi dari ketigavariabel bebas yang mendukung hipotesa. Oleh karena itu hasil uji dari penelitian ini menyatakan bahwa terdapat pengaruh antara variabel perencanaan karir, pengembangan karir, dan kompensasi terhadap kinerja karyawan Jambuluwuk Puncak Resort. Universitas Mercu Buana 2017-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3864 10.22441/jimb.v3i3.3864 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 3 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 444-454 2655-7274 2460-8424 10.22441/jimb.v3i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3864/2032 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/8116 2020-12-15T10:49:05Z jimb:ART driver

Pengaruh Lingkungan Kerja dan Disiplin Kerja Terhadap Kinerja Karyawan dengan Kepuasan Kerja Sebagai Variabel Intervening Pada CV. Kedai Kreasi Digital di Yogyakarta Wijayanti, Rita Ayu This study aims to analyze the influence of the work environment and work discipline on employee performance with job satisfaction as an intervening variable on the CV. Kedai Kreasi Digital in Yogyakarta. The variables used in this study are the work environment, work discipline, job satisfaction, and employee performance. The population in this study were all employees of CV. Kedai Kreasi Digital in Yogyakarta, amounting to 60 employees. The method used in sampling is the census, which is a sampling technique by taking the entire population, so that the total sample of this study is 60 employees. Data analysis methods include Descriptive Analysis and Path Analysis using SPSS for Windows version 23. The results of the study indicate that 1) The work environment has a positive and significant effect on employee performance. 2) Work discipline has a positive and significant effect on employee performance. 3) The work environment has a positive and not significant effect on employee performance with job satisfaction as an intervening variable. 4) Work discipline has a positive and significant effect on employee performance with job satisfaction as an intervening variable. Universitas Mercu Buana 2020-07-27 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8116 10.22441/jimb.v6i2.8116 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 2 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 211 - 226 2655-7274 2460-8424 10.22441/jimb.v6i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/8116/3599 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3834 2018-09-08T01:59:08Z jimb:ART driver

PERAN MANAJEMEN SUMBER DAYA MANUSIA STRATEGIK DALAM MENCIPTAKAN KEUNGGULAN KOMPETITIF PERUSAHAAN (Studi pada Industri Perhotelan Tingkat Menengah di Kota Malang) Suryaningtyas, Dianawati Asna, Asna manajemen sumber daya manusia strategik; peran Manajer SDM strategik; keunggulan kompetitif; metode kualitatif; Perubahan lingkungan eksternal sudah semakin mengglobal. Perusahaan harus menggunakanstrategi untuk mampu bertahan dalam menghadapi persaingan bisnis yang semakin tajam dan tidakmenentu, serta memiliki keunggulan kompetitif yang berkelanjutan. Peran manajemen sumber dayamanusia strategik menjadi kunci utama didalam perubahan manajemen perusahaan untuk meraihkeunggulan kompetitif. Untuk mewujudkan hal tersebut, Manajer Sumber Daya Manusia (Manajer SDM)harus mampu menjalankan peran strategik SDM dan memberikan nilai tambah bagi perusahaan sehinggakeunggulan kompetitif dapat dicapai. Namun belum banyak peran baru Manajer SDM diimplementasikan oleh perusahaan-perusahaan tingkat menengah, apalagi perusahaan pada tingkatan kecil. Penelitian inidilakukan dengan tujuan untuk mengetahui dan mengidentifikasi peran strategik Manajer SDM didalamusaha mengantisipasi persaingan bisnis saat ini, peran strategik Manajer SDM, serta menggunakan SDMsebagai faktor untuk menciptakan keunggulan kompetitif perusahaan. Penelitian ini dilakukan menggunakanmetode kualitatif pada industri perhotelan tingkat menengah di kota Malang. Asumsi filosofis yangmendasari adalah positivist. Teknik pengumpulan data dengan menggunakan semi-structured interview.Analisis data menggunakan coding dengan software NVivo International 10. Tema yang digunakan adalahPeran Manajer SDM berkontribusi menghadapi persaingan bisnis dan Peran strategik Manager SDM di dalammenciptakan keunggulan kompetitif perusahaan yang dianalisis berdasarkan number of coding reference.Hasilnya terdapat tiga partisipan yang telah menjalankan peran strategik SDM. Sedangkan tema SDM sebagaifaktor untuk mencapai keunggulan kompetitif perusahaan dianalisis berdasarkan text search query yangmenghasilkan pohon kata (Word Tree). Hasilnya adalah SDM digunakan sebagai faktor untuk mencapaikeunggulan kompetitif perusahaan Universitas Mercu Buana 2016-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3834 10.22441/jimb.v2i3.3834 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 3 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 846-854 2655-7274 2460-8424 10.22441/jimb.v2i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3834/2007 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3525 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3503 2018-08-24T07:02:50Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/15186 2022-08-02T07:18:30Z jimb:ART driver

Company's Financial Performance Before And After An Initial Public Offering: IPO At IDX In 2018 Telambanua, Saraswati Kurniasih, Augustina The research aims to analyze differences in a company's financial performance before and after an Initial Public Offering (IPO). The research period is one year before and one year after the IPO. The population of this research is a company that conducted an IPO and listed on the Indonesia Stock Exchange in 2018 which amounted to 55 companies. Sample withdrawal uses purposive sampling method and based on predetermined criteria samples obtained as many as 50 companies. The analysis method used is a different Wilcoxon Signed Rank Test. The results showed significant differences in liquidity performance (current ratio), solvency (debt to equity ratio), profitability (return on equity), and activity (total assets turnover) before and after the IPO. Keywords: Initial Public Offering (IPO); liquidity; solvablity; profitability; activity. Universitas Mercu Buana 2022-08-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15186 10.22441/jimb.v8i2.15186 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 2 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 162-174 2655-7274 2460-8424 10.22441/jimb.v8i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15186/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/20015 2023-12-02T02:57:17Z jimb:ART driver

Perceived Quality Analysis Using Importance Performance Analysis (IPA) Method in Teh Pucuk Harum Warpindyastuti, Lady Diana Setianingrum, Herlin Widasiwi Megaharti, Megaharti Perceived Quality; Importance Performance Analysis Perceived quality of a product is very important because it can be a factor in winning market competition. This study aims to determine what product attributes still need to be improved and which need to be maintained in the Teh Pucuk Harum packaged beverage product. The type of research used is mixed method. Data collection techniques using observation, surveys and interviews. As for data analysis using the Importance Performance Analysis (IPA) method. The results of the research show that the attributes of quality, design, and style still need to be improved and become the focus of the company. Meanwhile, price and feature attributes are considered less important by consumers, so they are not the focus of the company in its marketing strategy. Universitas Mercu Buana 2023-08-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/20015 10.22441/jimb.v9i2.20015 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 2 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 171-177 2655-7274 2460-8424 10.22441/jimb.v9i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/20015/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5610 2019-05-07T05:59:51Z jimb:ART driver

PENGARUH PERSEPSI HARGA, CITRA MEREK DAN CITRA NEGARA ASAL TERHADAP MINAT PEMBELIAN BODY BUTTER THE BODY SHOP Imaningsih, Erna S. Rianty, Elsa persepsi harga, citra merek, citra negara asal, minat pembelian Penelitian ini bertujuan untuk mengetahui pengaruh persepsi harga, citra merek dan citra negara asal pada minat pembelian Body Butter The Body Shop. Objek penelitian ini adalah mahasiswi Fakultas Ekonomi dan Bisnis, Universitas Mercu Buana, Jakarta yang pernah membeli produk Body Butter The Body Shop. Penelitian ini dilakukan pada 110 responden dengan menggunakan pendekatan kuantitatif. Teknik pengumpulan data yang digunakan adalah kuesioner dan menggunakan convenience sampling untuk pengambilan sampel. Analisis data yang digunakan adalah SEM dimana pengolahan data menggunakan program SmartPLS versi 3.0. Hasil penelitian menunjukkan variabel persepsi harga, citra merek dan citra negara asal signifikan pada niat pembelian Body Butter The Body Shop. Hal ini dibuktikan dari hasil pengujian hipotesis bootstrapping. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5610 10.22441/jimb.v4i3.5610 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 3 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 309 - 323 2655-7274 2460-8424 10.22441/jimb.v4i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5610/2551 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3983 2019-07-05T15:08:02Z jimb:ART driver

oai:ojs.publikasi.mercubuana.ac.id:article/11211 2021-03-31T18:46:12Z jimb:ART driver

EFFECT OF PROFITABILITY, LEVERAGE, INTEREST RATE, AND INFLATION ON FINANCIAL DISTRESS Nikodemus, Verra Theresia Oktasari, Dian Primanita Financial Distress is a phenomenon that shows a downward trend in a company's financial performance and is an early stage before bankruptcy. This study aims to examine the effects of profitability, leverage, interest rates, and inflation on the possibility of financial distress in the property and real estate sub-sector companies listed on the IDX. The population in this study was the property and real estate sub-sector companies listed on the IDX for the 2010-2018 period, and the sample selection method used was a purposive sampling method and obtained a sample of 153 companies. The method of data analysis was performed using logistic regression analysis with the E-Views 9 program. The results of this study show that profitability and leverage affect financial distress, while interest rates and inflation do not affect financial distress. Universitas Mercu Buana 2021-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11211 10.22441/jimb.v7i1.11211 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 1 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 139-154 2655-7274 2460-8424 10.22441/jimb.v7i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11211/4365 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3548 2018-08-25T05:35:19Z jimb:ART driver

HUBUNGAN ANTARA KEPUASAN KERJA DAN KOMITMEN ORGANISASI: STUDI KASUS DI HITAY INVESTMENT HOLDING Kuswibowo, Christian Job Satisfaction; Organizational Commitment; Three Dimentions of Organizational Commitment; Hitay Investment Holding; Is there any relationship between Job Satisfaction and Organizational Commitment?Today, one of the most fundamental issues of managers is improving job satisfaction ofthe employee and organizational commitment. It is impossible to get efficiency from anemployee who is not satisfied with his job and has a low organizational commitment.Therefore, these two concepts must be well understood to keep up the activities oforganizations in an effective way. Normally, enterprises should meet the expectations andneeds of the employees. Only in this way, the enterprises can motivate their employees.And employees will develop a commitment within the frame work of organizationalconditions in which they are motivated and satisfied and also by increasing theirperformance in this direction, they will make efforts in line with the objectives of theorganization itself. For this reason, which is vital in sustaining the business, the employeesmust do their best to increase job satisfaction and organizational commitment.In thisstudy, the effects of Job Satisfaction and Organizational Commitment were diagnosed.The research was carried out in Hitay Investment Holding in İstanbul. In order todetermine the job satisfaction, Manual for the Minnesota Satisfaction Questionnaire byWeiss, Dawis, England, Lofquist (1967) was used. the organizational commitment, Meyerand Allen (1997) The ‘Three-component model of organizational commitment’ was used.In the analysis process of the acquired data, an appropriate statistics programme has beenused with the demographical information of 89 employees have been collected.Correlation Coeffıcients and Regression Analysis has been applied in order to measure therelationship between job satisfaction and organizational commitment.Finally, it comes to aresult that there is a significant relationship between job satisfaction and organizationalcommitment. In the end of this thesis, some suggestions have been proposed to themanagers in order to increase the job satisfaction and organizational commitment ofemployees. Universitas Mercu Buana 2018-08-24 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3548 10.22441/jimb.v3i1.3548 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 1 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 92-99 2655-7274 2460-8424 10.22441/jimb.v3i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3548/1882 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3855 2018-09-10T02:58:30Z jimb:ART driver

IMPLEMENTASI MANAJEMEN INOVASI TERHADAP SUMBER DAYA UNTUK MENINGKATKAN KINERJA BISNIS INDUSTRI GARMEN DI DKI JAKARTA Soelton, Mochamad Ramli, Yanto Sumber Daya; Manajemen Inovasi; Kinerja Bisnis; Tujuan dari penelitian ini adalah untuk melakukan penyelidikan terhadap implementasimanajemen inovasi terhadap sumber daya untuk meningkatkan kinerja bisnis industrigarmen di DKI Jakarta. Sumber daya merupakan aset produktif yang dimiliki perusahaanindustri garmen, sumber daya sendiri tidak akan memiliki nilai apabila tidakdikembangkan dengan baik dan tepat. Inovasi merupakan bagian yang sangat pentingdalam manajemen strategi bagi perusahaan dalam meningkatkan keunggulan bersaingmelalui pengembangan sumber daya yang ada. Dengan melakukan pengembangan inovasiterhadap sumber daya perusahaan akan dapat meningkatkan kinerja bisnis perusahaantersebut untuk menghadapi persaingan globalisasi. Universitas Mercu Buana 2018-09-10 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3855 10.22441/jimb.v3i3.3855 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 3 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 298-310 2655-7274 2460-8424 10.22441/jimb.v3i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3855/2023 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3532 2018-09-03T04:11:29Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3690 2018-09-03T03:22:17Z jimb:ART driver

IDENTIFIKASI KEPUASAN KONSUMEN DITINJAU DARI SEGI HARGA DAN KUALITAS PADA RESTORAN ABUBA STEAK DI GREENVILLE Ruslim, Tommy Setiawan Rahardjo, Mukti price; service quality; satisfaction; At the time of the current era of globalization, every company should be able to compete with competitorsin order to survive. The most striking is the intense competition in the food industry, the number ofcompetitors and substitute products, Is very vulnerable to those who engaged in it to be able to compete if they can not satisfy customers. To that end, the authors are interested in creating a research against one ofthe restaurants there, by taking Abuba steak at Greenville as research material, with price as theindependent variable (X1) and quality service as the independent variable (X) to satisfaction as thedependent variable (Y). This research is done by spreading the questionnaire to 100 respondents. Throughthe data processing with PASW 18.00 is known that price as independent variable (X2) and service quality(X2), but only service quality (X21) have a significant effect on customer satisfaction (Y). Note that for 0.472for satisfaction variation can be explained by the variable price and service quality of 0.283 while the restcan be explained by other variables. With the linear regression equation is Y = 9.251 - 0.084 (X) + 0.450(X). Universitas Mercu Buana 2016-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3690 10.22441/jimb.v2i1.3690 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 1 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 472-485 2655-7274 2460-8424 10.22441/jimb.v2i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3690/1901 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/33091 2025-08-20T14:28:46Z jimb:ART driver

The Effect of Education, Training, and Self-Efficacy on Interest in Entrepreneurship Through Motivation in BTN Santri Developer Kebangsaan Training Participants in Java Nurullah, Tubagus Saef Putra, Suadi Sapta Yuliantini, Tine Hotimah, Husnul Education, Training, Self-Efficacy, Motivation, Entrepreneurial Interest This research aims to analyze the influence of education, training, self-efficacy on entrepreneurial interest with motivation as an intervening variable.  The total sample was 131 respondents National Savings Bank National Savings Bank Training Participants Alumni on the island of Java who were taken using a questionnaire. Data analysis was carried out with SEM Smart PLS 4.0.9.9. The results showed that the influence of education and self-efficacy on positive motivation was significant, the influence of training on positive motivation was not significant, the influence of training and motivation on entrepreneurial interest was significantly positive, the influence of education on entrepreneurial interest was negative and not significant. Self-efficacy towards negative entrepreneurial interest. The role of motivation mediates the influence of education and self-efficacy on entrepreneurial interest, whereas motivation does not mediate the influence of training on entrepreneurial interest. Universitas Mercu Buana 2025-07-28 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33091 10.22441/jimb.v11i2.33091 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 2 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 189-206 2655-7274 2460-8424 10.22441/jimb.v11i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/33091/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3495 2018-08-29T09:05:27Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/26598 2024-08-08T16:56:37Z jimb:ART driver

Examining Indonesian Gen Z Muslim Consumers' Purchase Intentions for Muslim Fashion on Shopee: A TPB Extension Perspective Fortunata, Sabrina Hanafiah, Ali E-WOM; Quality Product; TPB; Indonesian Gen Z Muslim; Shopee. Shopee is the leading online shopping platform in Southeast Asia and Taiwan. Currently, there is competition in the Islamic market through e-commerce. The purpose of this study was to examine and analyze the effect of e-wom, product quality, attitudes, subjective norms, and perceived behavioral control on the purchase intention of shopee e-commerce. The object of this research is Generation Y and Z Muslim women in Indonesia asmany as 231 respondents. The approach used in this research is quantitative. From the PLS-SEM data analysis method, with analysis tool Smart-PLS 3.2.9., it show that e-wom has a positive and significant effect on purchase intention, and quality product has a positive and significant effect on purchase intention. Moreover, the initial predictor variables derived from TPB (attitude, subjective norms, perceived behavioral control) continue to exhibit a positive correlation with the behavioral intention to purchase Muslim fashion among Generation Z individuals in Indonesia, aligning with the original TPB theory. Universitas Mercu Buana 2024-08-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/26598 10.22441/jimb.v10i2.26598 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 2 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 195-212 2655-7274 2460-8424 10.22441/jimb.v10i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/26598/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/26598/6255 Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6938 2020-07-27T02:42:04Z jimb:ART driver

PENGARUH BUDAYA KERJA DAN MOTIVASI KERJA TERHADAP KINERJA KARYAWAN DENGAN KEPUASAN KERJA SEBAGAI VARIABEL INTERVENING Kurniawan, Ferdy Budaya Kerja, Motivasi Kerja, Kinerja Karyawan dan PekerjaanKepuasan. Era pasar bebas penuh dengan tantangan berat, bagi para pemain ekonomi di dunia industri dan dunia bisnis sehingga para pelaku ekonomi didorong untuk berusaha menjadi yang terbaik dan terpenting. Pelaku ekonomi harus mampu bersaing dengan terus meningkatkan kinerja perusahaan mereka untuk menjaga kelangsungan hidup perusahaan. Dalam dunia perbankan manajemen sumber daya manusia merupakan elemen penting karena sebagai tulang punggung dalam menjalankan roda kegiatan operasional bank. Kinerja karyawan di PT. Bank Mandiri (Persero) Tbk area Bandar Lampung mengalami penurunan pada tahun 2016 dan 2017 sehingga penulis tertarik untuk meneliti pengaruh budaya kerja dan motivasi kerja terhadap kinerja karyawan dengan kepuasan kerja sebagai variabel intervening. Penelitian ini dianalisis menggunakan analisis jalur. Data yang digunakan dalam penelitian ini menggunakan data primer yang diperoleh dari 125 jawaban responden terhadap karyawan PT. Bank Mandiri (Persero) Tbk di Wilayah Bandar Lampung. Hasil penelitian mendukung hipotesis yang diajukan bahwa budaya kerja dan motivasi kerja baik secara simultan dan terus-menerus mempengaruhi kepuasan kerja dan kinerja karyawan. Hasil analisis jalur menunjukkan bahwa pengaruh langsung budaya kerja dan motivasi kerja terhadap kinerja karyawan lebih besar daripada efek tidak langsung melalui kepuasan kerja. Berdasarkan hasil ini, direkomendasikan bahwa perusahaan dapat meningkatkan kesadaran karyawan dalam mematuhi peraturan yang ada meskipun tidak ada pengawasan, memberikan insentif, memahami tugas dan promosi sehingga dapat memacu karyawan untuk bekerja lebih optimal. Universitas Mercu Buana 2019-12-06 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6938 10.22441/jimb.v5i3.6938 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 3 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 241-255 2655-7274 2460-8424 10.22441/jimb.v5i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6938/2990 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/10730 2021-03-31T18:45:08Z jimb:ART driver

EVALUATION BUSINESS STRATEGY NEIRA COFFE SHOP USING BUSINESS MODEL CANVAS APPROACH Ramelan, Muchammad The high competition in the coffee shop business and promising opportunities make Neira coffee shops able to adapt and develop their business. This study aims to evaluate the business strategy of the Neira coffee shop with a canvas model business approach as well as to design a new business model through five porter analysis and SWOT analysis including identification of internal and external factors. This research is a descriptive qualitative research with indept interview method. The results of this research show that the development of a business model in seven blocks on the canvas business model, namely the development of the customer segment is a type of professional worker or entrepreneur. In Customer Relationship, the development obtained is push notification email/ WhatsApp; Revenue Streams development is a consignment fee; Key Resources development is a customer database; Key Activity development is a continuous online promotion; Key Partnership development is namely partnering with bakery shops; and development on the Cost Structure is the cost of developing innovation Universitas Mercu Buana 2021-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10730 10.22441/jimb.v7i1.10730 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 1 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 128-138 2655-7274 2460-8424 10.22441/jimb.v7i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10730/4364 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3699 2018-09-03T06:58:47Z jimb:ART driver

ANALISIS FAKTOR–FAKTOR SISTEM INFORMASI MANAJEMEN PENGEMBANGAN SISTEM INFORMASI MANAJEMEN SDM DI Kantor Bank Danamon di Jakarta Selatan Provinsi DKI Jakarta Hermanto, Djamarel sistem informasi manajemen; sistem informasi; Tujuan dari penelitian ini adalah untuk mengetahui dan mempelajari tentang pengaruh sistem informasimanajemen di Kantor Bank Danamon, Jakarta Selatan Provinsi DKI Jakarta. Metode penelitian yangdigunakan dalam penelitian ini adalah survei ekspanatory dengan jenis penelitian survey. Hasil pengujiandari lima indikator laten variabel sistem informasi manajemen memiliki keandalan yang efektif dankonsistensehingganilaivarianceextractedbermaknabagiinformasidalamvariabellaten. Universitas Mercu Buana 2016-07-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3699 10.22441/jimb.v2i2.3699 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 2 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 605-611 2655-7274 2460-8424 10.22441/jimb.v2i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3699/1909 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/585 2018-09-03T03:15:44Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/578 2018-09-03T02:57:19Z jimb:ART driver

ANALISIS KINERJA KEUANGAN PT ADIRA DINAMIKA MULTI FINANCE TBK DENGAN ANALISIS RASIO DAN ANALISIS DU PONT Yansi, Nur Hari Tetuko, Bambang This research is conducted based on the declining net profit of high in PT Adira Dinamika Multi Finance, Tbk in the period 2013 to2014. This research intents to measure the company performances by using analysis ratio and Du Pont. This research is conducted in February 2015 to June 2015.The method used in this research is quantitative descriptive research method, in which the financial state of the company studied is examined and analyzed using analysis ratio and Du Pont. The sample and the population in this research are financial report of PT Adira Dinamika Multi Finance, Tbk in the period 2013 to 2014.The results of the research of the financial performance of PT Adira Dinamika Multi Finance, Tbk measured using analysis ratio and Du Pont in the period 2013 to 2014 decreased. From the analysis found that too high a load that is not proportional to the increase in sales resulting in ROE to decline. Based on the conclusion above, the implication give to the company is the company must be improve the performance and increasing net profit margin with decrease costs and increase sales. Then the company profit and performace will be better.Keyword : Financial Ratios, Du Pont, Financial Statement Universitas Mercu Buana 2016-05-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/578 10.22441/jimb.v1i3.578 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 3 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 368-381 2655-7274 2460-8424 10.22441/jimb.v1i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/578/506 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/32295 2025-04-10T02:03:31Z jimb:ART driver

Transformational Leadership and Organizational Innovation: The Mediating Role of Organizational Learning Juliasa, Made Aristana, I Nengah Adiandari, Ade Maharini Widanti, Ni Putu Kusuma Transformational Leadership, Organizational Learning, and Organizational Innovation Nowadays, innovation has become an important thing for organizations to do. The cause of this situation is the rapid development of business in the era of globalization, where business actors must always be dynamic in seeking and filling opportunities created in the market. This study analyzes the influence of transformational leadership, organizational learning, and organizational innovation. Qualitative and quantitative data were obtained from both primary and secondary sources by conducting interviews, observations, and distributing questionnaires. The population of this study was all export-oriented small and medium enterprises (SMEs) registered with the Department of Trade and Industry in Bali. The sampling technique used saturated sampling with the random sampling method, saturated sampling so that the number of samples obtained was 66 SMEs. The results of this study indicate that leadership has a significant effect on organizational learning and organizational innovation. Organizational learning has been proven to play a role as a mediator in the relationship between transformational leadership and organizational innovation. Universitas Mercu Buana 2025-04-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32295 10.22441/jimb.v11i1.32295 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 1 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 87-99 2655-7274 2460-8424 10.22441/jimb.v11i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/32295/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3496 2018-08-24T07:02:50Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/23017 2024-03-31T13:40:44Z jimb:ART driver

The Influence of Social Media Marketing and Brand Image on Intention to Purchase Residential Apartments Tarigan, Arihta Noverin, Devina Tasya Social Media Marketing;Brand Image;Purchase Intention;Apartment;Social Media;Instagram The rising attraction towards the real estate sector in the Jabodetabek region, particularly apartments due to land limitations, has prompted developers to adopt social media platforms for marketing their offerings. A notable player, PT PP Properti Tbk, employs Instagram as a tool for showcasing its products. This study’s objective is to assess how social media marketing and brand image impact the inclination to buy residential apartment products by PT PP Properti Tbk. This research is a descriptive quantitative investigation that establishes and elucidates links between variables. It focuses on individual variables without drawing parallels or associations with others. The sampling technique comprises a questionnaire, distributed to 122 respondents. These respondents are consumers who have follow and engaged with call-to-action (CTA) on the Instagram account @ppproperti. Data analysis was facilitated through SPSS 26 software, encompassing validity, reliability, and hypothesis testing. The research findings highlight that both social media marketing and brand image, collectively and individually, wield a favourable influence on the purchase intention for residential apartment products under PT PP Properti Tbk. These findings offer valuable insights for refining strategies in Instagram-based social media marketing and brand image, aimed at nurturing purchase intention. Furthermore, PT PP Properti Tbk can implement these research outcomes to heighten consumer interest in their residential apartment products in the times ahead. Universitas Mercu Buana Arihta Tarigan Devina Tasya Noverin 2024-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/23017 10.22441/jimb.v10i1.23017 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 1 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 81-96 2655-7274 2460-8424 10.22441/jimb.v10i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/23017/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/6844 2019-09-05T10:07:57Z jimb:ART driver

PENGARUH KOMPENSASI DAN DISIPLIN KERJA TERHADAP KINERJA KARYAWAN Wijaya, Purnamawati Hellen Widayati, Christina Catur Kusuma, Sigit H. kompensasi, disiplin kerja dan kinerja karyawan. Tujuan penelitian ini adalah untuk mengetahui dan menganalisis pengaruh kompensasi dan disiplin kerja terhadap kinerja karyawan pada Kantor Walikota Jakarta Selatan Pada Bagian Sekretariat Kota. Penelitian ini merupakan jenis penelitian asosiatif kausal yang bertujuan untuk menganalisis hubungan antara satu variabel dengan variabel lainnya atau bagaimana suatu variabel mempengaruhi variabel lain. Populasi dalam penelitian ini adalah karyawan yang bekerja di Kantor Walikota Jakarta Selatan Pada Bagian Sekretariat Kota.Metode pengambilan sampel menggunakan teknik sampling jenuh dengan jumlah sampel sebanyak 35 responden. Data primer dikumpulkan melalui penyebaran kuesioner, data sekunder dikumpulkan melalui studi pustaka.Metode analisis data yang digunakan adalah metode analisis deskriptif dan kuantitatif dengan teknik analisis regresi linier berganda. Hasil pengujian hipotesis penelitian menunjukkan bahwa variabel kompensasi tidak berpengaruh terhadap kinerja karyawan di Kantor Walikota Jakarta Selatan Pada Bagian Sekretariat Kota, namun disiplin kerja berpengaruh terhadap kinerja karyawan di Kantor Walikota Jakarta Selatan Pada Bagian Sekretariat Kota. Uji Koefisien Determinasi menunjukkan bahwa 36,4% kinerja karyawan dapat dijelaskan oleh variabel kompensasi dan disiplin kerja, sedangkan sisanya sebesar 63,6% dijelaskan oleh faktor-faktor lain yang tidak diikutsertakan dalam penelitian ini. Universitas Mercu Buana 2019-09-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6844 10.22441/jimb.v5i2.6844 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 2 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 289 - 310 2655-7274 2460-8424 10.22441/jimb.v5i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6844/2881 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/14076 2022-10-07T09:28:10Z jimb:ART driver

Fair Valuation of a Renewable Energy Company in Indonesia Fallery, Fallery Tjendrasa, Kin Renewable energy, mergers and acquisitions, disagreeable transaction value, fair firm value, DCF valuation Not only governments like Indonesia, but also many companies are eager to participate in the renewable energy sector to achieve their carbon neutral target due to the rise of environmental awareness. Mergers and acquisitions of the renewable company are opted by many companies to enter this new market. However, the buyer and the seller often experience disagreeable transaction value of the company, especially the value of the renewable company which does not have a long historical track record since renewable business is relatively new. DCF valuation method is applied to find the fair value of Alpha Co., a renewable energy company that could represent the new upcoming attractive market in Indonesia, renewable energy market. This study revealed that the fair value of Alpha Co. is USD 12.47 million with 10.74% and 10.76% of WACC in 2021 and after 2021 respectively. In addition, the sensitivity analysis proves the hypothesis about the significant influence made by the assumptions on which the most sensitive component could result in a 66.88% deviation from the original calculated firm value in this study. Universitas Mercu Buana 2022-03-31 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14076 10.22441/jimb.v8i1.14076 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 1 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 39-51 2655-7274 2460-8424 10.22441/jimb.v8i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/14076/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/15318 2023-11-30T15:11:24Z jimb:ART driver

The Role of Knowledge Sharing, Social Media, and Trust in Job Performance Rohman, Abdul Knowledge Sharing; Social Media; Trust; Job Performance The development of technological progress is the focus of the company's attention to survive in the era of competition. Technology is a key to winning the competition. Unfortunately, many human resources in the company cannot utilize technology properly. Social media is an excellent knowledge-sharing platform for now and can be used to improve job performance within an organization. Therefore, this study aims to measure the role of knowledge sharing, the use of social media and trust in employee performance at PT. XYZ. This research used a quantitative approach by gathering 128 respondents using non-probability sampling techniques with the census method. The data testing technique used in this study is SPSS 22.0. This study found that the use of social media in the workplace had a positive and significant effect on sharing knowledge, trust, and job performance. Meanwhile, knowledge sharing positively and significantly impacts job performance, and trust positively and significantly impacts job performance. Universitas Mercu Buana Abdul Rohman, Binus Business School-Master Program, Bina Nusantara University 2023-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15318 10.22441/jimb.v9i1.15318 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 1 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 37-53 2655-7274 2460-8424 10.22441/jimb.v9i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15318/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/38140 2026-04-04T08:45:13Z jimb:ART driver

Analysis of the Outcomes of the Alignment Activity in the Marketing Department of PT X Pauwah, Raghda Komariah, Ainur Sari, Maria Puspita Alignment, Marketing Departement, Vision and Mission, Validity Test, Human Resources This study aims to analyze the outcomes of the Alignment activity implemented in the Marketing Department of PT X, a batik manufacturing company located in Central Java, in aligning the company’s vision and mission and enhancing team work effectiveness. The study employs a quantitative research method using a Likert-scale questionnaire and open-ended questions administered to 11 employees who participated in the alignment activity. Data analysis was conducted through the calculation of mean scores, evaluation of open-ended responses, and validity testing using Pearson correlation. The results indicate that the alignment activity received a positive response, with the highest mean score observed in the internal communication aspect (4.37), followed by the collaboration aspect (91.27). However, the vision and mission understanding aspect obtained the lowest score (2.73), indicating the need for improvement in the methods used to communicate the company’s strategic direction. The validity test results show that five out of six questionnaire items were valid, while one item was found to be invalid. Overall, the alignment activity proved to be effective in improving employee communication, engagement, and collaboration; however, further reinforcement is required in enhancing employees’ understanding of the company’s vision and mission to ensure optimal achievement of strategic objectives. Universitas Mercu Buana 2026-04-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/38140 10.22441/jimb.v12i1.38140 Jurnal Ilmiah Manajemen dan Bisnis; Vol 12, No 1 (2026): Jurnal Ilmiah Manajemen dan Bisnis; 73-82 2655-7274 2460-8424 10.22441/jimb.v12i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/38140/pdf Copyright (c) 2026 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/4399 2018-11-19T07:02:24Z jimb:ART driver

ANALISIS PENGARUH KEPEMIMPINAN TRANSFORMASIONAL DAN KOMPENSASI TERHADAP KEPUASAN KERJA KARYAWAN PADA PT. FAJAR PIKIRAN RAKYAT KOTA SERANG Permana, Angrian Arief, Rizky Transformational Leadership; Compensation; Job Satisfaction; This study aims to determine how much influence of TransformationalLeadership and Compensation to Job Satisfaction Employees at PT. Fajar PikiranRakyat. The independent variable is Transformational Leadership as (X), andCompensation as (X) and the dependent variable is Employee Satisfaction (Y).The method used is a quantitative descriptive method that aims to determinewhether there is the influence of the independent variable that isTransformational Leadership and Compensation to the dependent variable of JobSatisfaction. The unit of analysis used is employees of PT. Fajar Pikiran Rakyat,with a total population of 54 employees who are also taken as a sample.Technical analysis of data used is descriptive statistics, classical assumption test,the coefficient of determination, multiple linear regression analysis, andhypothesis testing. The result of this research can be concluded thatTransformational Leadership variable has a significant effect on Job Satisfactionvariable, Compensation variable has significant effect to Job Satisfactionvariable, Transformational Leadership variable and Compensation havesignificant influence simultaneously to Job Satisfaction variable. Universitas Mercu Buana 2018-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4399 10.22441/jimb.v4i1.4399 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 1 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 53-61 2655-7274 2460-8424 10.22441/jimb.v4i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4399/2165 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3530 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/566 2018-08-25T04:29:54Z jimb:ART driver

EVALUASI DESAIN OPERASI PELAYANAN PERBANKAN Maheswari, Hesti Rawikara, Yuga This thesis discusses the Customer ratings for services provided and determine the factors that are considered essential services by customers, but not both in its implementation. The data obtained by conducting direct observation by distributing questionnaires to the Customer SRB Majesty Eternal Blessings and through direct interviews to the company to get the data: Technical characteristic and direction of development is used to obtain the data directly from the company The sampling technique used was convenience sampling, whereas analytical tool used is the analysis of the Quality Function Deployment (QFD), Validity and reliability of test data. From the test results showed twenty-eight attributes are distributed through the questionnaire questions, the importance and validity test of consumer satisfaction, twenty-eight of the attributes of all the items declared invalid and the test analysis HOQ reliabel.dan there needs to be redesigned because it is not accordance with the expectations of the customers nyaitu expertise and skills in serving customers, direct visits to clients' homes, and response to customer suggestions and criticisms. For further research is recommended to add another variable to the expanded scope of the study. Keywords: Service Of Quality, Quality Function Deployment, House Of Quality  Universitas Mercu Buana 2016-05-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/566 10.22441/jimb.v1i1.566 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 1 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 102-116 2655-7274 2460-8424 10.22441/jimb.v1i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/566/497 Copyright (c) 2016 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/30380 2024-12-05T03:27:30Z jimb:ART driver

The Influence Facility Work on The Employee's Performance of Vocational High School of Rosma Karawang District Indriyanti, Veronica Pangesti Solehudin, Solehudin Human resorce; Organization; Work facilities; Employee performance The potential of every human resource in an organization must be utilized as well as possible so as to be able to provide optimal work results. The achievement of the goals set by an organization does not only depend on modern equipment, complete facilities and infrastructure, but also depends on the people who carry out the work. The success of an organization is greatly influenced by the performance of individual employees. This study aims to determine the effect of staff organization on staff performance in Rosma Vocational Secondary School, Karawang District. This type of research is quantitative research using descriptive and observational research methods. There are 69 samples in this study. The survey method used in this study is a satisfaction survey. The research findings of this study use a multi-line exploratory research method. The results showed that Rosma Vocational High School, Karawang District, is among the institutions that affect employee performance Universitas Mercu Buana 2024-12-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/30380 10.22441/jimb.v10i3.30380 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 3 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 384-389 2655-7274 2460-8424 10.22441/jimb.v10i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/30380/pdf Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/13931 2022-12-15T10:40:39Z jimb:ART driver

Consumer Value Perception Model as Consideration for Fusion Beverage Business Sustainability Hamdan, Hamdan Raharja, Indra Ilhamalimy, Ridho Rafqi Ali, Hapzi perceived Outlet image, perceived hedonic, perceived utility, perceived value, perceived variation This research is about consumers’ perception of value in deciding to consume fusion drinks. Fusion drink is a drink that combines various basic ingredients, such as coffee, sugar, milk, tea, cheese, chocolate, yakult and various other basic ingredients. Perceived value arises when consumers decide to consume fusion drinks. This is because, the value contained when consuming fusion drinks is to get pleasure and happiness from various flavors and aromas, where the benefits obtained from various services and offers, as well as the image of the outlet also provide added value. This study seeks to determine the effect of perceived utility, perceived variation, perceived outlet image, perceived hedonic, and perceived value used to build the research model, by conducting an online survey of how these factors are related. The findings of this study are the perceived utility, perceived variation, perceived outlet image, perceived hedonic, and perceived value have a real relationship in shaping positive attitudes and behavior of consumers in deciding to consume fusion drinks. Universitas Mercu Buana Biro Penelitian, Pengabdian Masyarakat dan Publikasi 2022-12-15 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13931 10.22441/jimb.v8i3.13931 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 3 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 347-364 2655-7274 2460-8424 10.22441/jimb.v8i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/13931/pdf_1 Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/19177 2023-12-16T07:24:23Z jimb:ART driver

Strategic Organizational Performance at Electric Company in Indonesia Afrianda, Rio Zainal, Veithzal Rivai Siswanti, Indra The goal of the study is to examine how organizational performance is impacted by transformational leadership and strategic organizational change management, with organizational environment serving as a mediating element in Indonesia's electricity state-owned enterprises. This is a quantitative, non-experimental study conducted between October 2022 and January 2023 in the divisions of PLN Head Quarter, as well as its subsidiaries and affiliates, with 1.429 respondents. SPSS and LISREL are used to do the analysis. According to research, both strategic organizational change management and transformational leadership styles have a positive and significant impact on organizational climate, with strategic organizational change management having the most significant impact. Organizational climate, strategic organizational change management, and transformational leadership all have a positive and significant impact. Universitas Mercu Buana 2023-12-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/19177 10.22441/jimb.v9i3.19177 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 3 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 369-383 2655-7274 2460-8424 10.22441/jimb.v9i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/19177/pdf Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5628 2019-12-12T10:28:12Z jimb:ART driver

MANAJEMEN RANTAI PASOK PRODUK BERAS RI1 ORGANIK (STUDI KASUS PT. SWASEMBADA ORGANIS) Fauziya, Lia Sitorus, Ediyanto Pengukuran Performansi, Supply Chain, Supply Chain Operation Reference (SCOR), Analytical Hierarchy Process (AHP). PT Swasembada Organis merupakan perusahaan yang belum pernah melakukan pengukuran kinerja secara sistematik menggunakan sistem pengukuran kinerja atau metode tertentu. Seiring berjalannya waktu banyak masalah yang terjadi di PT Swasembada Organis yaitu mengalami masalah dalam kinerja supply chain nya, bahan baku yang di dapat dari supplier mengalami kendala sehingga mengakibatkan terlambatnya supply bahan baku perusahaan, sehingga berdampak kepada supply ke KFC yang terlambat. Di karenakan hal yang demikian sehingga kinerja supply chain managemnet nya tidak baik, sehinga perlu diadakan penelitian yang membahas tentang pengukuran kinerja supply chain management. Penelitian ini bertujuan untuk mengukur performa mana yang bermasalah dalam kinerja supply chain tersebut, dan kemudian menentukan strategi yang paling tepat untuk perbaikan kedepannya. Penulis menggunakan jenis penelitian deskriptif, dengan pendekatan kuantitatif. Metode yang digunakan untuk mengukur performa supply chain adalah Supply Chain Operations Reference (SCOR). Pengukuran performansi dalam penelitian ini juga didukung oleh metode Analytical Hierarchy Process (AHP) dengan diolah menggunakan alat sintesis atau software yaitu Expert Choice 2000. Hasil dari penelitian menunjukkan bahwa hasil analisis menggunakan metode AHP, yang menjadi alternative strategi atau pengukur kinerja utama adalah Stabilitas Produksi, Lead time pemenuhan pesanan, Keakuratan Persediaan, Kinerja Pengiriman dan Memenuhi Kebutuhan Pelanggan. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5628 10.22441/jimb.v5i1.5628 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 1 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 93 - 111 2655-7274 2460-8424 10.22441/jimb.v5i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5628/2567 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/11858 2021-11-30T15:43:04Z jimb:ART driver

The Level Of Use And Acceptance Towards Online Learning In Covid-19 Pandemic (Case Study Of College Students In Pontianak) Yosita, Melya Aisyah, Aisyah Pratiwi, Windi Adoption of Technology; Acceptance; Use; Attitude Toward Technology This research to determine the perceptions of college students in Pontianak City on the level of adoption, use and acceptance of online learning during the COVID-19 pandemic. This research is a descriptive quantitative using non-probability sampling with purposive sampling and quota sampling techniques. The sample of this research is college students in Pontianak City with 180 respondents. The data analysis technique used is descriptive analysis with a focus on the elements of the average. The results showed the respondents 'responses regarding Attitude, Affect and Motivation towards online learning when the Covid-19 epidemic obtained the highest index value of 153, included in the high category, respondents' responses regarding Perceived Behavioral Control obtained an index value of 145.5 also included in the high category. Meanwhile, the respondents' responses regarding Perceived Behavioral Control have an index value of 120.5 in the medium category. The conclusion of research is that college students in Pontianak City prefer face-to-face learning activities compared to online learning. The ease of use of the online education platform and the acquisition of higher scores were also felt by students when participating in online learning. The majority of university students in Pontianak are still not satisfied with online learning Universitas Mercu Buana Universitas Panca Bhakti 2021-11-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11858 10.22441/jimb.v7i3.11858 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 3 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 340-347 2655-7274 2460-8424 10.22441/jimb.v7i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11858/4941 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/35815 2025-12-04T03:24:26Z jimb:ART driver

Unveiling Fisheries Supply Chain Performance with SCOR: Challenges for Food Security amid Climate Change Iskandar, Yelita Anggiane Vikaliana, Resista Situmeang, Echa Ratu Prety Claudia Layman, Pauline Nancy Desline Fisheries Supply Chain; Climate Change Adaptation; Food Security; SCOR Model; Performance Measurement Indonesia’s capture fisheries sector plays a critical role in sustaining coastal livelihoods and national food security; however, production from both aquaculture and capture fisheries has not shown stability nor met the targets of the KKP Strategic Plan (RENSTRA) 2020-2024. In Fisheries Management Area (WPP) 713, particularly Teluk Aru, South Kalimantan, fish catch volumes have been declining, driven by the dual pressures of climate change and inefficiencies in fishing practices, storage, and supply chain management. These challenges not only threaten the availability of fish as a key protein source but also undermine economic growth and community resilience. This study seeks to evaluate the performance of the fisheries supply chain in Teluk Aru by designing indicators that explicitly incorporate climate change adaptation and food security dimensions, which remain underexplored in prior research. Data were collected through surveys, observations, and Focus Group Discussions (FGDs) with fishers, collectors, consumers, and local stakeholders, and analyzed using the Analytic Hierarchy Process (AHP) within the Supply Chain Operations Reference (SCOR) framework. The results identified 17 valid and relevant key performance indicators (KPIs), yielding an overall performance score of 43.71 out of 81.00, categorized as “low.” With only one KPI meeting its target, the findings underscore the urgent need for policy action and supply chain improvements to enhance resilience and sustainability in the fisheries sector. Universitas Mercu Buana 2025-12-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/35815 10.22441/jimb.v11i3.35815 Jurnal Ilmiah Manajemen dan Bisnis; Vol 11, No 3 (2025): Jurnal Ilmiah Manajemen dan Bisnis; 319-336 2655-7274 2460-8424 10.22441/jimb.v11i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/35815/pdf Copyright (c) 2025 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3838 2018-09-10T02:38:32Z jimb:ART driver

PENGARUH KESELAMATAN DAN KESEHATAN KERJA (K3) DAN PENGEMBANGAN KARYAWAN TERHADAP KINERJA KARYAWAN PADA PT TRIPARI TANGERANG Soelton, Mochamad Budiyanti, Lisa safety and health at work; employee development; employee performance; This study is a study of the occupational safety and health and employee development to employee performance at PT TRIPARI Tangerang, the study was conducted on 40 respondents using quantitative descriptive approach. By using two independent variables, occupational safety and health, development of employee and one dependent variable is the employee performance. This study aims to determine the effect of occupational safety and health (X1) and employee development (X2) on employee performance (Y).The results of this study indicate simultaneously (F test) variable occupational safety and health and development of employees together have a positive and significant impact on the employee performance, partially (t test) employee development has positive and significant impact on employee performance. Universitas Mercu Buana 2018-09-10 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3838 10.22441/jimb.v3i2.3838 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 2 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 138-149 2655-7274 2460-8424 10.22441/jimb.v3i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3838/2011 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3984 2019-07-05T15:33:14Z jimb:ART driver

PENGARUH KEPEMIMPINAN DAN MOTIVASI TERHADAP KINERJA KARYAWAN DI PT. UNITED CAN COMPANY Magito, Magito kepemimpinan; motivasi; kinerja karyawan. Tujuan dari penelitian ini adalah untuk menguji pengaruh kepemimpinan transformasional dan motivasi terhadap kinerja karyawan di PT. United Can Company. Penelitian ini menggunakan metode survey. Populasi dalam penelitian ini adalah seluruh karyawan PT. United Can Company yang berjumlah 30 karyawan dengan menggunakan sampel jenuh. Pengukuran tanggapan responden terhadap kuesioner dengan menggunakan 5 jenjang skala Likert. Data yang telah terkumpul diuji dengan metode regresi linier berganda. Hasil penelitian ini, bahwa kepemimpinan berpengaruh positif signifikan terhadap kinerja karyawan pada PT. Unitd Can Company.  Motivasi berpengaruh positif signifikan terhadap kinerja karyawan pada PT. Unitd Can Company. Universitas Mercu Buana 2018-11-14 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3984 10.22441/jimb.v4i2.3984 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 2 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 248-260 2655-7274 2460-8424 10.22441/jimb.v4i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3984/2245 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/9786 2020-12-15T10:40:37Z jimb:ART driver

Relevansi Nilai dan Nilai Prediktif pada Penghasilan Saham di BEI Suwarni, Suwarni Noviantoro, Rinto Noviantoro, Rinto Soleh, Ahmad Soleh, Ahmad Fahlevi, Mochammad Fahlevi, Mochammad Value Relevance, Predictive Value, Incomes, Stock After the convergence of IFRS in Indonesia, according to Statement of Financial Accounting Standards 1, economic entities are required to provide information about comprehensive income in their financial statements. This regulatory change is expected to improve the quality of earnings as measured by value relevance and predictive value. The purpose of this study is to find out more about the effect of IFRS convergence in Indonesia, especially regarding the presentation of comprehensive income, on the quality of net income and comprehensive income as measured by value relevance and predictive value. Furthermore, the value relevance and predictive value of comprehensive income will be compared with the value relevance and predictive value of net income. This study uses a quantitative approach, with a sample of entities listed on the Indonesia Stock Exchange in 2011-2014, except for companies in the financial sector. The results showed that there was a significant value relevance and predictive value for both comprehensive income and net income. However, when comparing the value relevance and predictive value of the two incomes, it is found that net income is superior to net income. However, it should be noted that the advantages of net income compared to comprehensive income are not significant. Universitas Mercu Buana 2020-12-08 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/9786 10.22441/jimb.v6i3.9786 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 3 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 273 - 283 2655-7274 2460-8424 10.22441/jimb.v6i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/9786/3994 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3685 2018-09-03T02:44:11Z jimb:ART driver

ANALISIS PENGARUH INFORMASI LAPORAN KEUANGAN TERHADAP PERUBAHAN HARGA SAHAM SEBELUM DAN SELAMA KRISIS EKONOMI INDONESIA (STUDI KASUS PERUSAHAAN G0 PUBLIK DI BEJ) Harahap, Irwan Mangara Information of financial statements; financial ratios; stock price changes; crisis economists This study examined the effect of financial statement information on stock price movements on the companywent public on the JSE. Financial statement information represented financial ratios commonly used in capitalmarkets that is Earnings Per Share (EPS), Price EarningRatio (PER), Price to Book Value (PBV), Debt to EquityRatio (DER), Return On Investment (ROI) , Return On Equity (ROE) and Profit Margin (PM). Economic crisis isused as the cut-off study due to previous research by many companies in Indonesia affected either directly orindirectly so that there is a significant difference between the period before the 'economic crisis and during theeconomic crisis. The population in this study is the go-public company listed on the Jakarta Stock Exchange in 1995-1999. The number of companies registered during the period amounted to 204 companies from variousindustries. The research sample also uses the company from all types of industries and using purposivesampling method and the number of population after selected according to the criteria obtained a sample of104 companiesThe research data is secondary data obtained from PRPM Jakarta, Semarang PIPM, JSX CornerDiponegoro, Indonesia Capital Market Directory and Internet (Indoexchange.com and jsx.co. id) The resultsshow that by using the level of a -. 5% variable EPS, PBV significantly in the period before and during the crisis.DER variable sigmifikan only in the period before the 'crisis. Variable ROI and ROE significant only in the periodbefore the crisis, while the PER and the PM variable is not significant at all periods. Taken together well in theperiod before and during the crisis of financial ratio variables (independent variables) influence sigmifikan tovariable changes in stock prices (the dependent variable). Economic crisis also significantly differentiate theeffect between the period before of during the economic crisis. Universitas Mercu Buana 2015-06-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3685 10.22441/jimb.v1i2.3685 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 2 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 250-256 2655-7274 2460-8424 10.22441/jimb.v1i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3685/1897 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/6955 2020-12-15T10:48:43Z jimb:ART driver

PENGARUH PELATIHAN KERJA DAN DISIPLIN KERJA TERHADAP PRODUKTIVITAS KERJA KARYAWAN DI PT MAAQO JOMBANG ATI, Nur Fadilah PELATIHAN KERJA, DISIPLIN KERJA, DAN PRODUKTIVITAS KERJA PT MAAQO Jombang is an industriall compny thats poduces botted dringking water in jombang. This studiy aims to determine wheater or not the influence of job training and work discipline on the work productivity of employees at PT MAAQO. Thes type of reseearch ussed  this studiy iquantitative reseaarch with an associative approach. The sampling  technique used was saturated samples with a sample of 76 employees at PT MAAQO. This sudy uses the technique of collecting data on obsevations, interviews, questionnaires an documentation. Datanalysis techniiques ussed are multipple liner regressions analisis, t test and f test with results. Universitas Mercu Buana 2020-04-22 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6955 10.22441/jimb.v6i1.6955 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 1 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 30 - 40 2655-7274 2460-8424 10.22441/jimb.v6i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6955/3353 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/15970 2022-08-02T07:18:30Z jimb:ART driver

Service Quality And Brand Awareness Intervention In Affecting Customer Satisfaction At The Bri Bank Pomalaa Unit Titing, Andry Stepahnie Sudarnice, Sudarnice Wonua, Almansyah Rundu Service Quality, Brand Awareness , Customer Satisfaction This study aims to determine the effect of service quality and Brand Awareness  toward customer satisfaction of Bank BRI Unit Pomalaa. The type of research used is Explanatory Research with a quantitative approach. The population in this study are the customers of Bank BRI Unit Pomalaa. The data collected using a questionnaire with samples taken as many as 74 respondent. In analyzing the data in this study using SmartPLS. The result of the partial analysis showed that service quality and Brand Awareness  has a positive and significant influence on customer satisfaction. Variables of service quality and Brand Awareness  has a positive and significant on customer satisfaction of 82,1% Universitas Mercu Buana 2022-08-02 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15970 10.22441/jimb.v8i2.15970 Jurnal Ilmiah Manajemen dan Bisnis; Vol 8, No 2 (2022): Jurnal Ilmiah Manajemen dan Bisnis; 227-238 2655-7274 2460-8424 10.22441/jimb.v8i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/15970/pdf Copyright (c) 2022 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/18905 2023-12-02T02:57:17Z jimb:ART driver

The Influence Of Job Resourcefulness On Job Crafting Mediated By Work Engagement At Employees In Sheraton Hotel Surabaya Restaurant Nur Fatimah, Ekawati Putri Job Crafting, Individual Crafting, Collaborative Crafting, Job Resourcefulness, Work Engagement This study aims to explain how the relationship between job resourcefulness towards individual crafting and collaborative crafting is mediated by work engagement. Respondents used in this study were employees of the Sheraton Surabaya Hotel & Towers restaurant, amounting of 53 respondents. This research uses a quantitative method with census sampling and uses Partial Least Square (PLS) analysis method. The test results show that job resourcefulness has a significant effect on work engagement. The effect of job resourcefulness on individual crafting and collaborative crafting has a significant effect. Then, the test results show that work engagement can mediate the relationship of job resourcefulness with individual crafting and collaborative crafting.  Universitas Mercu Buana Airlangga University 2023-08-03 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/18905 10.22441/jimb.v9i2.18905 Jurnal Ilmiah Manajemen dan Bisnis; Vol 9, No 2 (2023): Jurnal Ilmiah Manajemen dan Bisnis; 239-251 2655-7274 2460-8424 10.22441/jimb.v9i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/18905/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/18905/4104 Copyright (c) 2023 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/5616 2019-05-07T05:59:51Z jimb:ART driver

PERBANDINGAN KEPUASAN PELANGGAN PENGGUNA JASA MOBIL ONLINE DI JAKARTA ( Studi Kasus Jasa Mobil Online Grab Car, Go Car dan Uber Car) Viciwati, Viciwati kepuasan pelanggan, jasa mobil online Penelitian ini bertujuan untuk Melihat ada atau tidaknya perbedaan kepuasan pelanggan pengguna jasa mobil online Grab Car, Go Car dan Uber Car dan melihat Jasa mobil online mana yang paling memuaskan pelangganya. Berdasarkan hasil penelitian maka terlihat bahwa maka terlihat bahwa ada perbedaan kepuasan pelanggan pengguna mobil on line, dimana jenis mobil Uber Car mempunyai nilai yang berbeda saat dibandingkan dengan jenis mobil Go Car dan Grab Car. Dan untuk mengetahui jenis mobil online mana yang sudah memuaskan pelanggan di antara ke tiga jenis mobil on line tersebut maka mobil on line Go Car yang sudah memberikan kepuasan yang signifikan kepada pelangganya. Universitas Mercu Buana 2019-05-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5616 10.22441/jimb.v4i3.5616 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 3 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 381 - 399 2655-7274 2460-8424 10.22441/jimb.v4i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/5616/2556 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/11932 2021-07-30T16:25:49Z jimb:ART driver

FINANCIAL STRATEGY IN DECISION MAKING FOR MARINA BUSINESS DEVELOPMENT IN BENOA BALI (CASE STUDY: PT. PELINDO PROPERTI INDONESIA) Kumar, Mahde Ismiyanti, Fitri Financial Feasibility Analysis, Benoa Marina, Marina Development, NPV, IRR, PI A company needs to determine the strategies that will be implemented by the company, after the strategy is set the company needs to consider the steps that must be taken so that the chosen strategy can provide added value to the company. Financial performance is one of the measuring tools that can be used in assessing the success of the strategy taken by the company and to know the amount of added value the strategy provides to the company's performance. Several financial indicators that can be used to determine financial performance such as NPV (Net Present Value), IRR (Internal Rate of Return), PP (Payback Period) and PI (Profitability Index) are indicators commonly used by companies, those are no exception for PT. Pelindo Properti Indonesia. PT. Pelindo Properti Indonesia (PT. PPI) is a subsidiary of PT. Pelabuhan Indonesia III (Persero). As a new company, PT. PPI needs to show good performance to its stakeholders, PT. BJTI and PT. Pelindo III, one of which is through a development strategy in the business division that contributes the most to the company, the Benoa Marina Bali business division. This research is a quantitative descriptive research and uses data collection through in-depth interviews and data processing by using financial indicators such as NPV, IRR, PP and PI. The results of the financial feasibility analysis on the development of marina in Benoa are feasible based on calculations on indicator of  NPV, IRR and PI. The payback period for Benoa marina development occurred in the 13th year of the 6th month. Based on the sensitivity test of funding combination using self capital and debt in the form of a shareholder loan, the most optimal combination is a combination of 50% equity and 50% debt. Universitas Mercu Buana PT. Pelindo Properti Indonesia, Dr. Fitri Ismiyanti SE., M.Si. 2021-07-30 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11932 10.22441/jimb.v7i2.11932 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 2 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 223-230 2655-7274 2460-8424 10.22441/jimb.v7i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/11932/4651 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3746 2018-09-05T04:18:38Z jimb:ART driver

PENGARUH FAKTOR-FAKTOR FUNDAMENTAL DAN FAKTOR EKSTERNAL TERHADAP RETURN SAHAM PADA SAHAM LQ-45 DI BURSA EFEK INDONESIA PERIODE 2007-2010 Abdat, Fatmah Amir Return on Asset (ROA); Return on Equity (ROE); Debt to Equity Ratio (DER); Book Value Per Share (BVS); Earnings Per Share (EPS); Suku Bunga; Nilai Tukar; Return Saham; Interest Rates; Exchange Rates; Stock Return; Penelitian ini bertujuan untuk mengungkapkan pengaruh fundamental dan faktor eksternal yangmempengaruhi return saham. Variabel yang digunakan dalam penelitian ini yaitu Return on Asset (ROA),Return on Equity (ROE), Debt to Equity Ratio (DER), Book Value Per Share (BVS), Earnings Per Share (EPS),Suku Bunga (SB) dan Nilai Tukar (NT) terhadap Return Saham. Data dalam penelitian ini adalah perusahaanyang pernah masuk dalam saham LQ-45 tahun 2007-2010, dan memenuhi kriteria pemilihan sampel sehinggadiperoleh sampel sebanyak 65 perusahaan. Penelitian ini menggunakan analisis yaitu Metode Efek Random.Pengolahan data dilakukan dengan menggunakan program Eviews. Hasil yang didapat adalah 4 variabel yangberpengaruh secara signifikan yaitu DER, BVS, EPS dan Suku Bunga. Sedangkan secara bersama-sama ROA,ROE, DER, BVS, EPS, Suku Bunga dan Nilai Tukar berpengaruh signifikan terhadap return saham. Universitas Mercu Buana 2016-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3746 10.22441/jimb.v2i3.3746 Jurnal Ilmiah Manajemen dan Bisnis; Vol 2, No 3 (2016): Jurnal Ilmiah Manajemen dan Bisnis; 751-776 2655-7274 2460-8424 10.22441/jimb.v2i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3746/1929 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3860 2018-09-10T03:02:12Z jimb:ART driver

PENGARUH ATRIBUT PRODUK DAN PENGETAHUAN KONSUMEN TENTANG PRODUK BERLABEL HALAL TERHADAP KEPUTUSAN PEMBELIAN DI KFC (Studi Kasus Pada Pengunjung KFC Daan Mogot) Perkasa, Didin Hikmah Wakhid, Makhmud Amin Atribut Produk; Ilmu Konsumen; Keputusan Pembelian; Penelitian ini merupakan studi atribut produk dan pengetahuan konsumen terhadapkeputusan pembelian pada restoran makanan cepat saji KFC daan mogot, penelitian inidilakukan terhadap 100 responden dengan menggunakan pendekatan deskriptif kuantitatif.Dengan menggunakan dua variabel bebas yaitu atribut produk, pengetahuan konsumendan variabel terikatnya adalah keputusan pembelian. Penelitian ini bertujuan untukmengetahui pengaruh atribut produk (X1) dan pengetahuan konsumen tentang produkyang diberi label halal (X2) terhadap keputusan pembelian (Y). Hasil penelitian inimenunjukkan secara simultan (F test) variabel atribut produk dan pengetahuan konsumententang produk yang diberi label sebagai halal bersama memiliki dampak positif dan signifikan terhadap keputusan pembelian. Secara parsial (t test) variabel atribut produk dan pengetahuan konsumen tentang produk yang diberi label sebagai halal bersama memiliki dampak positif dan signifikan terhadap keputusan pembelian. Universitas Mercu Buana 2017-11-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3860 10.22441/jimb.v3i3.3860 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 3 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 385-397 2655-7274 2460-8424 10.22441/jimb.v3i3 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3860/2028 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/6985 2020-12-15T10:49:05Z jimb:ART driver

Pengaruh Promosi dan Kualitas produk terhadap Minat beli Kerudung Rabbani Aini, Nur ' 224466 Penellitian ini bertujuaan untuk: 1. Mengetahui pengaruh promosi terhadaap minatbeli, 2. Mengetahui apakh kualitas produk berpengaruh terhadp minatbeli, 3. Apakah promosi dan kualitas produk berpengaruh terhadp minatbeli. Penelitian ini menggunakn jenis penellitian uraian (explanatory research) dan pendekatn kuantitatif. Variabel yang dipakai pada penelitian ini ada tiga, yaitu Promosi (X1), Kualitas produk(X2) dan MinatBeli (Y). Pengambilan data didapat dari penyebaraan kuesioner secara offline kepada Mahasiswi yang berdomisili di Pondok Pesantren Putri Walisongo Cukir Jombang yang memiliki umur antra 18 thun sampai 23. Sampel yang dipakai pada penelitian ini berjumllah 109 orang responden.Teknik pengambiln sampel yaang digunakanya itu purposive sampling. Analisi data yaang di pakai ialah analisis regressi linier berganda. Hasil penelitian menggambarkan bahwa variabel promosi berpengaruh terhadap proses keputusan pembelian, kemudian variabel kualitas produk berpengaruh terhadp proses keputusan pembelian. Promosi dan kualitas produk secara bersama-bersama berpengaruh terhadap minatbeli. Dari hasil penelitian ini, se baiknya pihak Rabbani dapat mempertahnkan serta meningkatkaan promosi dan kualitas produk, karena variabel promosi dan kuliatas produk memiliki pengaruh yaang dominan untuk mempengaruhi minatbeli. Universitas Mercu Buana universitas asyim asy'ari 2020-07-27 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6985 10.22441/jimb.v6i2.6985 Jurnal Ilmiah Manajemen dan Bisnis; Vol 6, No 2 (2020): Jurnal Ilmiah Manajemen dan Bisnis; 165 - 173 2655-7274 2460-8424 10.22441/jimb.v6i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6985/3595 Copyright (c) 2020 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3537 2018-09-03T04:11:29Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/3624 2018-08-29T09:15:44Z jimb:ART driver

ANALISA PERENCANAAN STRATEGIS PENGELOLAAN SDM PADA PDAM TIRTA PAKUAN KOTA BOGOR Gani, Abdul Strategic planning; human resource management; Every company is attempting to reach the objective and performance’s goal that has been determinedbefore with the human resources organization. Getting the aim of the organization achievement is used tomeasure the success of management and employee. To bring about the company vision, mission, objective andstrategy that will be achieved in long period requires the integrated management system between humanresources organization and functional strategic planning system of human resources management so t hatstrategy of implementation planning can be reached optimal likewise Water Supply Company Owned by LocalGovernment ( PDAM) as a general service business that give the top priority in satisfied service for society willbe influenced by the accuracy in formulating the strategy operated by management, therefore the writerdecides to write this paper with tittle “ Strategic Planning for Human Resources Management in PDAM TirtaPakuan Kota Bogor”. Based on the existing condition of PDAM as observation object the case is: What process and problemfaced in the implementation of strategic planning for human resources management in PDAM Tirta PakuanKota Bogor. That at used the writer used some research instruments such as questioners that have beendisseminated in all chairmen in PDAM. There are 39 responses which the examination analysis use by CFA(confirmatory factor analysis), but the writer also use the business strategic model by J. David Hunger &Thomas L Wheelen and Integrated of Performance Human Resources Management System based on balancedscorecard by Mulyadi. There are four main factors which have to got important role in strategic planning system, theya are:(i) human resources competence as a factor to determine strategic planning, then, (ii) performance assessment,employee satisfaction and functional strategic planning. Based on the environment analysis and SWOT analysis, the company is situated in 3 quadrant thatcan be interpreted is growing phase. In spite of the result score ia regarded as the low growth rate relatively. Itis significant to find the weakness of internal human resources with the achievement of strategic planning offunctional human rescorces management. Indication of that case has not been the performance assessmentsystem for employee based on actual performance. The other solution for this case faced by a company,recommended in strategic planning arrangement process use approach by the integrated management systemwith a perspective balanced scorecard, as one of a management instrument to evaluate how succesfull are themission, vision, objective and goals. Besides the integration is available in arranging of strategic planning ofhuman resources management, it is done by strategy map to be used as the arrangement of the establishmentprogram and employee development Universitas Mercu Buana 2015-06-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3624 10.22441/jimb.v1i2.3624 Jurnal Ilmiah Manajemen dan Bisnis; Vol 1, No 2 (2015): Jurnal Ilmiah Manajemen dan Bisnis; 153-167 2655-7274 2460-8424 10.22441/jimb.v1i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3624/1886 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3520 2018-08-29T09:05:28Z jimb:ART

oai:ojs.publikasi.mercubuana.ac.id:article/6833 2019-09-05T10:07:57Z jimb:ART driver

ANALISIS SWOT DALAM MENENTUKAN STRATEGI PEMASARAN ALAT RUMAH TANGGA DI PT IMPRESSINDO KARYA STEEL JAKARTA-PUSAT Haerawan, Haerawan Magang, Yulius Here Analisis SWOT, Strategi Pemasaran Produk, Produk Alat Rumah Tangga Tujuan penelitian ini adalah untuk meneliti: (1) Kelebihan strategi pemasaran PT. Impressindo Karya Steel Jakarta-Pusat dalam memasarkan Produk Alat Rumah Tangga; (2). Kelemahan strategi pemasaran PT. Impressindo Karya Steel Jakarta-Pusat dalam memasarkan Produk Alat Rumah Tangga; (3) Peluang strategi pemasaran PT. Impressindo Karya Steel Jakarta-Pusat dalam memasarkan Produk Alat Rumah Tangga; (4) Tantangan strategi pemasaran PT. Impressindo Karya Steel Jakarta-Pusat dalam memasarkan Produk Alat Rumah Tangga. (5) Strategi pemasaran yang harus digunakan oleh PT. Impressindo Karya Steel Jakarta-Pusat dalam memasarkan Produk Alat Rumah Tangga; (6) Matrik grand strategi pemasaran yang harus digunakan oleh PT. Impressindo Karya Steel Jakarta-Pusat dalam memasarkan Produk Alat Rumah Tangga. Metode penelitian yang digunakan adalah kualitatif. Teknik pengumpulan data dengan angket. Teknik analisis data dengan analisis SWOT. Hasil penelitian ini adalah sebagai berikut: Strategi Pemasaran Produk Alat Rumah Tangga Di PT. Impressindo Karya Steel Jakarta-Pusat. Berada pada posisi KUADRAN 3 yaitu Perusahaan menghadapi peluang yang sangat besar, tetapi di pihak lain menghadapi beberapa kendala/kelemahan internal. Fokus strategi Perusahaan ini adalah meminimalkan masalah-masalah internal perusahaan sehingga dapat merebut peluang yang lebih baik. Universitas Mercu Buana 2019-09-05 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6833 10.22441/jimb.v5i2.6833 Jurnal Ilmiah Manajemen dan Bisnis; Vol 5, No 2 (2019): Jurnal Ilmiah Manajemen dan Bisnis; 175 - 189 2655-7274 2460-8424 10.22441/jimb.v5i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/6833/2873 Copyright (c) 2019 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/28298 2024-08-19T04:16:31Z jimb:ART driver

Growth Strategy for Start-Up Businesses: Analysis of Solutions for Scalability, Marketing, and Risk Management Yuwono, Imam Rakhmawati, Nur Endah Putri, Nurulita Purnama Growth Strategy, Solution Analysis, Scalability, Marketing, Risk Management Start up businesses experiencing difficulties in their growth process, especially in terms of scalability, marketing, and risk management. Scalability is the ability of a business to increase its operational scale without reducing efficiency and effectiveness. Marketing is the process of promoting a product or service so that it is known to the public and attracts consumer interest. Risk management is an action taken by the company to reduce the negative impact of unwanted events. Based on this background, research will be carried out entitled: "Business Start-up Growth Strategy: Analysis of Solutions for Scalability, Marketing and Risk Management”. The methods used in this study are qualitative and quantitative research methods. Qualitative research methods are used to gain an in-depth understanding of solutions for scalability, marketing, and risk management Start up business. In this case the researcher will conduct an interview with the founder or manager of the Start up, view and analyze related documents and records, and make direct observations. on activities Start up. The purpose of this research is to analyze how this happens. Start-up businesses can overcome difficulties such as scalability, marketing, and risk management as they grow and provide recommendations for effective growth strategies can overcome problems and can help strengthen the business sector and make a positive contribution to the economy. To provide enlightenment to the public, the results of the research will be published in an Accredited Journal. Universitas Mercu Buana 2024-08-07 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/28298 10.22441/jimb.v10i2.28298 Jurnal Ilmiah Manajemen dan Bisnis; Vol 10, No 2 (2024): Jurnal Ilmiah Manajemen dan Bisnis; 261-275 2655-7274 2460-8424 10.22441/jimb.v10i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/28298/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/downloadSuppFile/28298/6753 Copyright (c) 2024 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/4404 2018-11-19T07:41:12Z jimb:ART driver

PENGARUH BEBAN KERJA DAN MOTIVASI KERJA TERHADAP KINERJA KARYAWAN BPJS KETENAGAKERJAAN CABANG SALEMBA Sugiharjo, R. Joko Aldata, Friska beban kerja; motivasi kerja; kinerja karyawan; Penelitian ini bertujuan untuk mengetahui pengaruh beban kerja terhadap kinerja karyawan, untuk mengetahui pengaruh motivasi kerja terhadap kinerja karyawa. Jumlahpopulasi dalam penelitian ini sebanyak 47orang karyawan BPJS Ketenagakerjaan CabangSalemba di Jakarta. Pengujian hipotesis dengan menggunakan moto deanalisis deskriptif,metode analisis statistik yang terdiri dari analisis regresi linear berganda, pengujian parsial (Uji-t) dan pengujian koefisien determinasi (RJurnal Ilmiah Manajemen dan Bisnis, Volume IV, No.01, Maret 2018: 132-141 2). Hasil penelitian pada pengujian secara parsial (Uji-t). Menunjukan bahwa variabel beban kerja berpengaruhpositif dan signifikan terhadap kinerja karyawan, variabel motivasi kerja berpengaruhpositif dan signifikan terhadap kinerja karyawan. Melalui pengujian koefisien determinasi(Adjusted RSquare) diperoleh nilai sebesar 0,643 atau 64,3%, artinya kinerja karyawandipengaruhi oleh beban kerja dan motivasi kerja sebesar 64,3% sedangkan sisanya 35,7% dipengaruhi variabel lain. Universitas Mercu Buana 2018-03-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4404 10.22441/jimb.v4i1.4404 Jurnal Ilmiah Manajemen dan Bisnis; Vol 4, No 1 (2018): Jurnal Ilmiah Manajemen dan Bisnis; 128-137 2655-7274 2460-8424 10.22441/jimb.v4i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/4404/2174 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/10660 2021-03-31T18:39:17Z jimb:ART driver

The Effect of Company Size and Financial Distress on Going Concern Audit Opinions with Opinion Shopping as Moderation Variables Utami, Fransisca Listyaningsih Qintharah, Yuha Nadhirah company size, financial distress, going concern audit opinions, opinion shopping. This study aims to examine the effect of  company size and financial distress on going concern audit opinions with opinion shopping as moderation variables. The population in this study are companies with types of manufacturing industries listed on the Indonesia Stock Exchange in the period 2016 to 2018. The sample was obtained using a purposive random sampling method. Data analysis uses logistic regression and different absolute values. The results showed that company size and financial distress affected going concern audit opinions, opinion shopping did not affect company size on going concern audit opinions and opinion shopping affected financial distress on going concern audit opinions. Universitas Mercu Buana 2021-04-01 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10660 10.22441/jimb.v7i1.10660 Jurnal Ilmiah Manajemen dan Bisnis; Vol 7, No 1 (2021): Jurnal Ilmiah Manajemen dan Bisnis; 81-100 2655-7274 2460-8424 10.22441/jimb.v7i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/10660/4361 Copyright (c) 2021 Jurnal Ilmiah Manajemen dan Bisnis http://creativecommons.org/licenses/by-nc/4.0

oai:ojs.publikasi.mercubuana.ac.id:article/3543 2018-08-25T05:35:19Z jimb:ART driver

PENGARUH STANDARD PELATIHAN KERJA DAN ORGANIZATIONAL CITIZENSHIP BEHAVIOR TERHADAP KINERJA PEGAWAI PADA PANTI SOSIAL BINA NETRA “TAN MIYAT” BEKASI Soelton, Mochamad Hardiati, Siti Mutia Standard Vocational Trainning; Organizational Citizenship Behavior; Performance; This study aims to determine how the Effect Standard Training Work And OrganizationalCitizenship Behavior Toward Employee Performance On Social Institution Bina NetraTan Miyat Bekasi Ministry of Social Affairs the results of this research uses descriptivequantitative approach with Non probality Sampling method that uses ConvienenceSampling. Data collection using the questionnaire and subsequent analysis of data usingmultiple linear regression.whereas data processing for the Test Do With SPSS Statistics21. The results of this study indicate that both independent variables (variables andvariable training organization citizenship behavior) positive and significant effect onemployee performance Universitas Mercu Buana 2018-08-24 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3543 10.22441/jimb.v3i1.3543 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 1 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 30-47 2655-7274 2460-8424 10.22441/jimb.v3i1 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3543/1877 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/3851 2018-09-10T02:38:32Z jimb:ART driver

ANALISIS PERILAKU MAHASISWA DI KAMPUS DALAM MEWUJUDKAN LULUSAN SARJANA YANG BERKUALITAS (Studi Kasus Program Studi Manajemen S1feb-Umb Jakarta) Astuti, Yuni Herminingsih, Anik Suprapto, Suprapto sikap; pengaruh social; control individu; perilaku; Tujuan penelitian ini adalah untuk mengetahui dan menganalisis pengaruh variable sikap,norma subyektif / pengaruh sosial dan kontrol individu terhadap perilaku mahasiswa baiksecara parsial maupun simultan. Metode penelitian statistik parametrik menggunakandesain kuantitatif analisis regresi linier berganda yang pengolahan datanya diprosesdengan program SPSS 21. Jumlah sampel yang menjadi responden sebanyak 81mahasiswa dan instrument risert yang digunakan berupa kuesioner terstruktur denganskala likert. Hasil penelitian menunjukkan bahwaPerilaku Mahasiswa dipengaruhi secarasignifikan oleh faktor sikap dalam mewujudkan lulusan sarjana yang berkualitas. Universitas Mercu Buana 2018-09-10 info:eu-repo/semantics/article info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3851 10.22441/jimb.v3i2.3851 Jurnal Ilmiah Manajemen dan Bisnis; Vol 3, No 2 (2017): Jurnal Ilmiah Manajemen dan Bisnis; 235-252 2655-7274 2460-8424 10.22441/jimb.v3i2 eng https://publikasi.mercubuana.ac.id/index.php/jimb/article/view/3851/2019 Copyright (c) 2018 Jurnal Ilmiah Manajemen dan Bisnis

oai:ojs.publikasi.mercubuana.ac.id:article/590 2018-09-03T03:15:44Z jimb:ART

b32a7e57209ccb566d096ba183e294f5